BLASTX nr result
ID: Paeonia22_contig00031292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00031292 (849 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB53023.1| hypothetical protein L484_018907 [Morus notabilis] 59 3e-06 ref|XP_007217780.1| hypothetical protein PRUPE_ppa020022mg, part... 57 9e-06 ref|XP_007212918.1| hypothetical protein PRUPE_ppa022276mg, part... 57 9e-06 ref|XP_007199160.1| hypothetical protein PRUPE_ppa019714mg, part... 57 9e-06 >gb|EXB53023.1| hypothetical protein L484_018907 [Morus notabilis] Length = 902 Score = 58.5 bits (140), Expect = 3e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +1 Query: 652 LGEWLWRFPLEFDSLWCKILKSKYGLSEKGWDT 750 LG+WLWRFPLE DSLW +++SKYGL GWD+ Sbjct: 266 LGKWLWRFPLEQDSLWATVIRSKYGLHPNGWDS 298 >ref|XP_007217780.1| hypothetical protein PRUPE_ppa020022mg, partial [Prunus persica] gi|462413930|gb|EMJ18979.1| hypothetical protein PRUPE_ppa020022mg, partial [Prunus persica] Length = 1199 Score = 57.0 bits (136), Expect = 9e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = +1 Query: 658 EWLWRFPLEFDSLWCKILKSKYGLSEKGWDTPMNISSFFRSRW 786 +WLWRFPLE +SLW +I+KSKYG+ GWDT R+ W Sbjct: 1002 KWLWRFPLETNSLWHRIIKSKYGIDSNGWDTKQIDKVSCRNPW 1044 >ref|XP_007212918.1| hypothetical protein PRUPE_ppa022276mg, partial [Prunus persica] gi|462408783|gb|EMJ14117.1| hypothetical protein PRUPE_ppa022276mg, partial [Prunus persica] Length = 388 Score = 57.0 bits (136), Expect = 9e-06 Identities = 19/43 (44%), Positives = 31/43 (72%) Frame = +1 Query: 658 EWLWRFPLEFDSLWCKILKSKYGLSEKGWDTPMNISSFFRSRW 786 +WLWRFP+E +++W K++KSKYGL WD+ + ++ R+ W Sbjct: 77 KWLWRFPIETNAMWHKVIKSKYGLDSNDWDSKLTVTGSCRNPW 119 >ref|XP_007199160.1| hypothetical protein PRUPE_ppa019714mg, partial [Prunus persica] gi|462394560|gb|EMJ00359.1| hypothetical protein PRUPE_ppa019714mg, partial [Prunus persica] Length = 429 Score = 57.0 bits (136), Expect = 9e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = +1 Query: 658 EWLWRFPLEFDSLWCKILKSKYGLSEKGWDTPMNISSFFRSRW 786 +WLWRFPLE +SLW +I+KSKYG+ GWDT R+ W Sbjct: 81 KWLWRFPLETNSLWHRIIKSKYGIDSNGWDTKQIDKVSCRNPW 123