BLASTX nr result
ID: Paeonia22_contig00031079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00031079 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310140.1| hypothetical protein POPTR_0007s11010g [Popu... 58 2e-06 >ref|XP_002310140.1| hypothetical protein POPTR_0007s11010g [Populus trichocarpa] gi|222853043|gb|EEE90590.1| hypothetical protein POPTR_0007s11010g [Populus trichocarpa] Length = 760 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +3 Query: 78 IGSIGGITDCTTRVGREERIAMEMAVHDFYNLTGYKLALSLRNLAGKFDRTPFA 239 I IG + DC+ RVGREE+IAM++AV D Y LTG+ LAL + +L R FA Sbjct: 34 ISIIGAVVDCSIRVGREEKIAMDIAVQDIYRLTGHNLALHVLDLPENSARAAFA 87