BLASTX nr result
ID: Paeonia22_contig00030626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00030626 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047264.1| Remorin family protein, putative isoform 2 [... 55 8e-06 >ref|XP_007047264.1| Remorin family protein, putative isoform 2 [Theobroma cacao] gi|508699525|gb|EOX91421.1| Remorin family protein, putative isoform 2 [Theobroma cacao] Length = 439 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/69 (44%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = +2 Query: 191 VQMKLERKTSSLMDKILNKLKVSQMKAQEMRSSI-WESLDQTPKHKFNVETNSSEMRIVV 367 ++MKLE+K S+ MDKIL+KL+++QMKAQEMRSS+ + +Q PK V+ N+ + + Sbjct: 353 LEMKLEKKRSASMDKILSKLRMAQMKAQEMRSSMPAKENEQIPKTSQKVQENADFKLLFL 412 Query: 368 PQFQFYMQQ 394 FY Q+ Sbjct: 413 ADGIFYTQK 421