BLASTX nr result
ID: Paeonia22_contig00030471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00030471 (662 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS74199.1| putative gag-pol polyprotein [Fragaria x ananassa] 62 2e-12 >gb|ACS74199.1| putative gag-pol polyprotein [Fragaria x ananassa] Length = 1297 Score = 62.0 bits (149), Expect(2) = 2e-12 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 3/52 (5%) Frame = -1 Query: 527 FWAEAINHACYLVNRSSSRMFAFKCAKEVW---PAS*STTVL*RCGCSAHIP 381 FWAEA NHACYL+NRS SR FKCA+EVW P S + C AHIP Sbjct: 581 FWAEAANHACYLINRSPSRAINFKCAEEVWSGKPVDYSNLRVFGCSAYAHIP 632 Score = 36.2 bits (82), Expect(2) = 2e-12 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 646 QFLKFHRDEGITKHFTVKKNSQQ 578 +FL+ +DEGIT+HFTVKK+ QQ Sbjct: 531 KFLQLCKDEGITRHFTVKKSPQQ 553