BLASTX nr result
ID: Paeonia22_contig00030430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00030430 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62038.1| hypothetical protein VITISV_021371 [Vitis vinifera] 60 2e-07 >emb|CAN62038.1| hypothetical protein VITISV_021371 [Vitis vinifera] Length = 1123 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 231 TAKTECQVRYVVKNPDDINNEERISQKGRRSWLVFFNETDY 353 T KT CQV VVKN DDI E +IS+K RR WLVFFNETDY Sbjct: 232 TVKTGCQVLSVVKNIDDIGKEGKISRKTRRRWLVFFNETDY 272