BLASTX nr result
ID: Paeonia22_contig00030295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00030295 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC21915.1| 60S ribosomal protein L2 [Morus notabilis] 60 4e-07 gb|EXB94986.1| 60S ribosomal protein L2 [Morus notabilis] 59 9e-07 ref|XP_006359959.1| PREDICTED: 60S ribosomal protein L2, mitocho... 57 2e-06 ref|XP_006397582.1| hypothetical protein EUTSA_v10001757mg, part... 56 5e-06 ref|XP_006294885.1| hypothetical protein CARUB_v10023935mg, part... 56 5e-06 ref|XP_006291835.1| hypothetical protein CARUB_v10018009mg [Caps... 56 5e-06 ref|XP_006291834.1| hypothetical protein CARUB_v10018009mg [Caps... 56 5e-06 ref|XP_004294438.1| PREDICTED: 60S ribosomal protein L2, mitocho... 56 5e-06 ref|XP_002880081.1| ribosomal protein L2 family protein [Arabido... 56 5e-06 gb|AAM64400.1| unknown [Arabidopsis thaliana] 56 5e-06 emb|CAA57902.1| ribosomal protein L2 [Arabidopsis thaliana] 56 5e-06 ref|NP_566007.1| ribosomal protein L2 family protein [Arabidopsi... 56 5e-06 ref|XP_004246012.1| PREDICTED: 60S ribosomal protein L2, mitocho... 56 5e-06 >gb|EXC21915.1| 60S ribosomal protein L2 [Morus notabilis] Length = 204 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 S G+ GRTS TPWGKPCKSGYKTGPLKR+K Sbjct: 175 SGGNLGRTSQTPWGKPCKSGYKTGPLKRRK 204 >gb|EXB94986.1| 60S ribosomal protein L2 [Morus notabilis] Length = 169 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 S+G+ GRTS TPWGKPCKSGYKTGPLKR++ Sbjct: 140 STGNLGRTSQTPWGKPCKSGYKTGPLKRRE 169 >ref|XP_006359959.1| PREDICTED: 60S ribosomal protein L2, mitochondrial-like [Solanum tuberosum] Length = 202 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGS GR S+TPWGKP K GYKTGPLKRKK Sbjct: 173 SSGSHGRGSLTPWGKPTKGGYKTGPLKRKK 202 >ref|XP_006397582.1| hypothetical protein EUTSA_v10001757mg, partial [Eutrema salsugineum] gi|557098655|gb|ESQ39035.1| hypothetical protein EUTSA_v10001757mg, partial [Eutrema salsugineum] Length = 222 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 183 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 212 >ref|XP_006294885.1| hypothetical protein CARUB_v10023935mg, partial [Capsella rubella] gi|482563593|gb|EOA27783.1| hypothetical protein CARUB_v10023935mg, partial [Capsella rubella] Length = 244 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 205 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 234 >ref|XP_006291835.1| hypothetical protein CARUB_v10018009mg [Capsella rubella] gi|482560542|gb|EOA24733.1| hypothetical protein CARUB_v10018009mg [Capsella rubella] Length = 214 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 175 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 204 >ref|XP_006291834.1| hypothetical protein CARUB_v10018009mg [Capsella rubella] gi|482560541|gb|EOA24732.1| hypothetical protein CARUB_v10018009mg [Capsella rubella] Length = 169 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 130 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 159 >ref|XP_004294438.1| PREDICTED: 60S ribosomal protein L2, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 194 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGS G+ S TPWGKPCK GYKTGP KRKK Sbjct: 165 SSGSHGKCSRTPWGKPCKGGYKTGPNKRKK 194 >ref|XP_002880081.1| ribosomal protein L2 family protein [Arabidopsis lyrata subsp. lyrata] gi|297325920|gb|EFH56340.1| ribosomal protein L2 family protein [Arabidopsis lyrata subsp. lyrata] Length = 214 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 175 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 204 >gb|AAM64400.1| unknown [Arabidopsis thaliana] Length = 214 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 175 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 204 >emb|CAA57902.1| ribosomal protein L2 [Arabidopsis thaliana] Length = 169 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 130 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 159 >ref|NP_566007.1| ribosomal protein L2 family protein [Arabidopsis thaliana] gi|42571223|ref|NP_973685.1| ribosomal protein L2 family protein [Arabidopsis thaliana] gi|17380714|gb|AAL36187.1| unknown protein [Arabidopsis thaliana] gi|20197074|gb|AAM14906.1| Expressed protein [Arabidopsis thaliana] gi|20259009|gb|AAM14220.1| unknown protein [Arabidopsis thaliana] gi|330255274|gb|AEC10368.1| ribosomal protein L2 family protein [Arabidopsis thaliana] gi|330255275|gb|AEC10369.1| ribosomal protein L2 family protein [Arabidopsis thaliana] Length = 214 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGSRGRTSV+PWGKPCK GYK+ +K+KK Sbjct: 175 SSGSRGRTSVSPWGKPCKGGYKSASVKKKK 204 >ref|XP_004246012.1| PREDICTED: 60S ribosomal protein L2, mitochondrial-like [Solanum lycopersicum] gi|17644112|gb|AAK95390.1| ribosomal protein L2 [Solanum lycopersicum] Length = 202 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +1 Query: 1 SSGSRGRTSVTPWGKPCKSGYKTGPLKRKK 90 SSGS GR S+TPWGKP K GYKTGPLKR+K Sbjct: 173 SSGSHGRGSLTPWGKPTKGGYKTGPLKRRK 202