BLASTX nr result
ID: Paeonia22_contig00030213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00030213 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC01509.1| ATP synthase CF0 A chain, partial (chloroplast) [... 59 5e-07 dbj|BAK86702.1| ATP synthase CF0 A chain (chloroplast) [Sciadopi... 59 5e-07 ref|YP_001806690.1| ATP synthase CF0 A subunit [Cryptomeria japo... 59 5e-07 ref|YP_008965191.1| ATP synthase CF0 A chain (chloroplast) [Calo... 59 7e-07 gb|AFU97017.1| AtpI, partial (chloroplast) [Erythroxylum areolatum] 59 7e-07 gb|AFU97029.1| AtpI, partial (chloroplast) [Ixonanthes sp. CCD-2... 59 9e-07 ref|YP_009019779.1| ATP synthase CF0 A subunit (chloroplast) [Vi... 58 1e-06 ref|NP_042364.1| ATP synthase CF0 A subunit [Pinus thunbergii] g... 58 1e-06 ref|NP_054484.1| ATP synthase CF0 A subunit [Nicotiana tabacum] ... 58 1e-06 ref|YP_009000164.1| ATP synthase CF0 subunit IV (chloroplast) [S... 58 1e-06 ref|YP_009000084.1| ATP synthase CF0 subunit IV (chloroplast) [S... 58 1e-06 ref|YP_009000003.1| ATP synthase CF0 subunit IV (chloroplast) [S... 58 1e-06 ref|YP_008999923.1| ATP synthase CF0 subunit IV (chloroplast) [A... 58 1e-06 ref|YP_008963679.1| ATP synthase CF0 subunit IV (chloroplast) [L... 58 1e-06 ref|YP_008815105.1| ATP synthase CF0 subunit IV (chloroplast) [S... 58 1e-06 gb|AGW04732.1| ATP synthase CF0 A subunit [Orthosia scoparia] 58 1e-06 gb|AGW04655.1| ATP synthase CF0 A subunit [Matelea biflora] 58 1e-06 gb|AGW04578.1| ATP synthase CF0 A subunit [Marsdenia astephanoid... 58 1e-06 gb|AGW04506.1| ATP synthase CF0 A subunit [Eustegia minuta] 58 1e-06 gb|AGW04429.1| ATP synthase CF0 A subunit [Astephanus triflorus]... 58 1e-06 >gb|AGC01509.1| ATP synthase CF0 A chain, partial (chloroplast) [Sciadopitys verticillata] Length = 176 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAGFTKK LGYFG+YIQPT Sbjct: 83 DINTTVALALLTSVAYFYAGFTKKGLGYFGRYIQPT 118 >dbj|BAK86702.1| ATP synthase CF0 A chain (chloroplast) [Sciadopitys verticillata] Length = 248 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAGFTKK LGYFG+YIQPT Sbjct: 134 DINTTVALALLTSVAYFYAGFTKKGLGYFGRYIQPT 169 >ref|YP_001806690.1| ATP synthase CF0 A subunit [Cryptomeria japonica] gi|223635013|sp|B1VKH7.1|ATPI_CRYJA RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|171854948|dbj|BAG16688.1| ATP synthase CF0 subunit IV [Cryptomeria japonica] gi|239794316|dbj|BAH73313.1| ATP synthase CF0 subunit IV [Cryptomeria japonica] gi|239794399|dbj|BAH73395.1| ATP synthase CF0 subunit IV [Cryptomeria japonica] Length = 248 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAGFTK+ LGYFGKYIQPT Sbjct: 134 DINTTVALALLTSVAYFYAGFTKRGLGYFGKYIQPT 169 >ref|YP_008965191.1| ATP synthase CF0 A chain (chloroplast) [Calocedrus formosana] gi|482840949|dbj|BAN16940.1| ATP synthase CF0 A chain (chloroplast) [Calocedrus formosana] gi|563317776|dbj|BAO19874.1| ATP synthase CF0 A chain (chloroplast) [Calocedrus formosana] Length = 248 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTS+AYFYAGFTK+ LGYFGKYIQPT Sbjct: 134 DINTTVALALLTSIAYFYAGFTKRGLGYFGKYIQPT 169 >gb|AFU97017.1| AtpI, partial (chloroplast) [Erythroxylum areolatum] Length = 256 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAGF+KK LGYFGKYIQPT Sbjct: 142 DINTTVALALLTSVAYFYAGFSKKGLGYFGKYIQPT 177 >gb|AFU97029.1| AtpI, partial (chloroplast) [Ixonanthes sp. CCD-2012] Length = 256 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTS+AYFYAGF+KK LGYFGKYIQPT Sbjct: 142 DINTTVALALLTSIAYFYAGFSKKGLGYFGKYIQPT 177 >ref|YP_009019779.1| ATP synthase CF0 A subunit (chloroplast) [Vitis rotundifolia] gi|586947400|gb|AHJ91197.1| ATP synthase CF0 A subunit (chloroplast) [Vitis rotundifolia] Length = 247 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 133 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 168 >ref|NP_042364.1| ATP synthase CF0 A subunit [Pinus thunbergii] gi|1168600|sp|P41604.1|ATPI_PINTH RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|1262604|dbj|BAA04322.1| H+-ATPase a subunit [Pinus thunbergii] gi|357000225|gb|AET48092.1| ATP synthase CF0 A subunit (chloroplast) [Pinus hwangshanensis] gi|357000661|gb|AET48522.1| ATP synthase CF0 A subunit (chloroplast) [Pinus fragilissima] gi|357001321|gb|AET49173.1| ATP synthase CF0 A subunit (chloroplast) [Pinus densata] Length = 248 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 134 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 169 >ref|NP_054484.1| ATP synthase CF0 A subunit [Nicotiana tabacum] gi|28261705|ref|NP_783220.1| ATP synthase CF0 A subunit [Atropa belladonna] gi|78102519|ref|YP_358660.1| ATP synthase CF0 A subunit [Nicotiana sylvestris] gi|81301550|ref|YP_398847.1| ATP synthase CF0 A subunit [Nicotiana tomentosiformis] gi|91208976|ref|YP_538836.1| ATP synthase CF0 A subunit [Solanum bulbocastanum] gi|108773118|ref|YP_635627.1| ATP synthase CF0 A subunit [Solanum tuberosum] gi|351653863|ref|YP_004891588.1| atpI gene product (chloroplast) [Nicotiana undulata] gi|394831090|ref|YP_006503779.1| ATP synthase CF0 A chain (chloroplast) [Datura stramonium] gi|404474513|ref|YP_006666018.1| ATP synthase CF0 subunit IV (chloroplast) [Capsicum annuum] gi|60391819|sp|P69371.1|ATPI_ATRBE RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|60391820|sp|P69372.1|ATPI_TOBAC RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|122233123|sp|Q33C50.1|ATPI_NICTO RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|122233177|sp|Q3C1H1.1|ATPI_NICSY RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|122245044|sp|Q2MIJ9.1|ATPI_SOLBU RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|122248897|sp|Q2VEI8.1|ATPI_SOLTU RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|11813|emb|CAA77344.1| ATPase sunthase IV subunit [Nicotiana tabacum] gi|20068319|emb|CAC88032.1| ATPase subunit IV [Atropa belladonna] gi|77799546|dbj|BAE46635.1| ATPase IV subunit [Nicotiana sylvestris] gi|80750909|dbj|BAE47985.1| ATPase IV subunit [Nicotiana tomentosiformis] gi|82754617|gb|ABB90031.1| ATP synthase CF0 A chain [Solanum tuberosum] gi|84371883|gb|ABC56201.1| ATP synthase CF0 subunit IV [Solanum bulbocastanum] gi|88656792|gb|ABD47045.1| ATP synthase CF0 subunit IV [Solanum tuberosum] gi|329124570|gb|AEB72127.1| ATP synthase CF0 subunit IV (chloroplast) [Solanum tuberosum] gi|329124657|gb|AEB72213.1| ATP synthase CF0 subunit IV (chloroplast) [Solanum tuberosum] gi|347453889|gb|AEO95547.1| ATP synthase CF0 subunit IV (chloroplast) [Nicotiana undulata] gi|347454000|gb|AEO95657.1| ATP synthase CF0 subunit IV [synthetic construct] gi|350996414|gb|AEQ36926.1| ATP synthase CF0 A chain (chloroplast) [Datura stramonium] gi|350996501|gb|AEQ37012.1| ATP synthase CF0 A chain [Datura stramonium] gi|401065920|gb|AFP90764.1| ATP synthase CF0 subunit IV (chloroplast) [Capsicum annuum] gi|225273|prf||1211235H ATPase a Length = 247 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 133 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 168 >ref|YP_009000164.1| ATP synthase CF0 subunit IV (chloroplast) [Silene paradoxa] gi|555944253|gb|AGZ18154.1| ATP synthase CF0 subunit IV (chloroplast) [Silene paradoxa] Length = 248 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 134 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 169 >ref|YP_009000084.1| ATP synthase CF0 subunit IV (chloroplast) [Silene chalcedonica] gi|555944172|gb|AGZ18074.1| ATP synthase CF0 subunit IV (chloroplast) [Silene chalcedonica] Length = 248 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 134 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 169 >ref|YP_009000003.1| ATP synthase CF0 subunit IV (chloroplast) [Silene conoidea] gi|555944090|gb|AGZ17993.1| ATP synthase CF0 subunit IV (chloroplast) [Silene conoidea] Length = 248 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 134 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 169 >ref|YP_008999923.1| ATP synthase CF0 subunit IV (chloroplast) [Agrostemma githago] gi|555944009|gb|AGZ17913.1| ATP synthase CF0 subunit IV (chloroplast) [Agrostemma githago] Length = 248 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 134 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 169 >ref|YP_008963679.1| ATP synthase CF0 subunit IV (chloroplast) [Liquidambar formosana] gi|491650359|gb|AGL13419.1| ATP synthase CF0 subunit IV (chloroplast) [Liquidambar formosana] Length = 247 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 133 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 168 >ref|YP_008815105.1| ATP synthase CF0 subunit IV (chloroplast) [Schefflera delavayi] gi|458599512|gb|AGG39205.1| ATP synthase CF0 subunit IV (chloroplast) [Schefflera delavayi] Length = 247 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 133 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 168 >gb|AGW04732.1| ATP synthase CF0 A subunit [Orthosia scoparia] Length = 244 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 130 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 165 >gb|AGW04655.1| ATP synthase CF0 A subunit [Matelea biflora] Length = 244 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 130 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 165 >gb|AGW04578.1| ATP synthase CF0 A subunit [Marsdenia astephanoides] gi|544186946|gb|AGW04886.1| ATP synthase CF0 A subunit [Telosma cordata] Length = 244 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 130 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 165 >gb|AGW04506.1| ATP synthase CF0 A subunit [Eustegia minuta] Length = 247 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 133 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 168 >gb|AGW04429.1| ATP synthase CF0 A subunit [Astephanus triflorus] gi|544187024|gb|AGW04963.1| ATP synthase CF0 A subunit [Vincetoxicum rossicum] Length = 244 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 ELH*VIPLALLTSVAYFYAGFTKK*LGYFGKYIQPT 1 +++ + LALLTSVAYFYAG TKK LGYFGKYIQPT Sbjct: 130 DINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPT 165