BLASTX nr result
ID: Paeonia22_contig00030152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00030152 (206 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035033.1| Serine/threonine-protein kinase fray2, putat... 55 8e-06 >ref|XP_007035033.1| Serine/threonine-protein kinase fray2, putative [Theobroma cacao] gi|508714062|gb|EOY05959.1| Serine/threonine-protein kinase fray2, putative [Theobroma cacao] Length = 542 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -3 Query: 186 RFRFSDYRKNNPELLVLNLSDSFWDMVEYCLHPEPAKRPAAAELLKNQFFLNPK 25 RFRFSDY N+ E S +F DMV CL +PAKRP+A +LLK+ FF + K Sbjct: 248 RFRFSDYESNSKEGKSKKFSKAFKDMVASCLDQDPAKRPSAEKLLKHSFFKSCK 301