BLASTX nr result
ID: Paeonia22_contig00029929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00029929 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006590934.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE... 56 6e-06 >ref|XP_006590934.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Glycine max] Length = 675 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = +1 Query: 85 RATICCAVVDRGTIGIVSTFEVQEDVFHKGHLVCKKKP--EVRLDRETNEVSCDCRLLEF 258 RA I C+V R G + T++V ED+ +G K+ EV R+ ++ SC C L EF Sbjct: 512 RAKINCSVSLRDVEGSICTYDVLEDIIVEGQ---PKEAIFEVVFHRDNHDFSCKCLLFEF 568 Query: 259 KGIMCRHSLFVY 294 +GIMCRHSL V+ Sbjct: 569 RGIMCRHSLIVF 580