BLASTX nr result
ID: Paeonia22_contig00029705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00029705 (748 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511070.1| pentatricopeptide repeat-containing protein,... 59 2e-06 >ref|XP_002511070.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550185|gb|EEF51672.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 551 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/61 (45%), Positives = 45/61 (73%) Frame = +2 Query: 566 IRLMSCIEAQL*THRWETEFVADLFIRNNLIHVYSISNQAHYAYKVFDESSNRDVITYNV 745 + L C+ +Q+ ++ FV+DL++ N+LIHVYS+ + +YA +VFDESS+RDV++YN Sbjct: 153 LSLAQCLHSQV----FKFGFVSDLYVINSLIHVYSLFDCLNYACQVFDESSDRDVVSYNA 208 Query: 746 L 748 L Sbjct: 209 L 209