BLASTX nr result
ID: Paeonia22_contig00029360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00029360 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533770.1| pentatricopeptide repeat-containing protein,... 51 3e-10 ref|XP_007214420.1| hypothetical protein PRUPE_ppa026010mg, part... 56 6e-06 >ref|XP_002533770.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526307|gb|EEF28615.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 617 Score = 50.8 bits (120), Expect(2) = 3e-10 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 41 CAGMGLLESGKHVHVVSQKVYFQTDAYVSSRLLIMYTKIRK 163 CAGM LLE+GK VH +SQK F D YV+S L+ MY+K K Sbjct: 427 CAGMELLEAGKQVHAISQKAAFHEDIYVASGLIGMYSKCGK 467 Score = 39.3 bits (90), Expect(2) = 3e-10 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = +3 Query: 153 KSGKIDMTKHFFSESPNWVIVCLNSMVAGLSLNPLDMEA 269 K GK+D+ F + VC NSM+AGLSLN LD EA Sbjct: 464 KCGKMDIADCIFKKISKQDTVCWNSMIAGLSLNSLDNEA 502 >ref|XP_007214420.1| hypothetical protein PRUPE_ppa026010mg, partial [Prunus persica] gi|462410285|gb|EMJ15619.1| hypothetical protein PRUPE_ppa026010mg, partial [Prunus persica] Length = 679 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = +2 Query: 41 CAGMGLLESGKHVHVVSQKVYFQTDAYVSSRLLIMYTKIRKDRYDKAFFFRIPEL 205 CA MGLL++GK +H S+K FQTD YV+S LL MY+K + K F + EL Sbjct: 337 CAAMGLLQAGKEIHAASRKAAFQTDVYVASGLLNMYSKCGRTETAKHIFHNMLEL 391