BLASTX nr result
ID: Paeonia22_contig00029320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00029320 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 45 5e-08 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 45.4 bits (106), Expect(2) = 5e-08 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -2 Query: 451 LRWSF--LIFPNVKSCFGLRKEHRPSALNE 368 +RWS + FPNVKSC GLRKEHRPS LNE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 Score = 37.4 bits (85), Expect(2) = 5e-08 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 497 PLSFGSDKSSSFGRFAQV 444 PLSFGSDKSS FGRFAQV Sbjct: 17 PLSFGSDKSSPFGRFAQV 34