BLASTX nr result
ID: Paeonia22_contig00029231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00029231 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600212.1| hypothetical protein MTR_3g055560 [Medicago ... 58 1e-06 ref|XP_003622919.1| hypothetical protein MTR_7g058320 [Medicago ... 57 3e-06 ref|XP_003592213.1| hypothetical protein MTR_1g100160 [Medicago ... 57 3e-06 ref|XP_003614993.1| hypothetical protein MTR_5g062140 [Medicago ... 56 5e-06 ref|XP_003600952.1| hypothetical protein MTR_3g071380 [Medicago ... 56 5e-06 ref|XP_003614149.1| hypothetical protein MTR_5g045440 [Medicago ... 56 6e-06 ref|XP_003620991.1| Histone H4 [Medicago truncatula] gi|35549600... 56 6e-06 gb|ABN09786.1| Histone H4; Histone-fold [Medicago truncatula] 56 6e-06 ref|XP_003598300.1| hypothetical protein MTR_3g010070 [Medicago ... 55 8e-06 >ref|XP_003600212.1| hypothetical protein MTR_3g055560 [Medicago truncatula] gi|355489260|gb|AES70463.1| hypothetical protein MTR_3g055560 [Medicago truncatula] Length = 285 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/55 (45%), Positives = 34/55 (61%) Frame = -3 Query: 377 YAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKK 213 Y ++LVD+D + Q ++++ GY F+V V YER P C C IGHTI CKK Sbjct: 103 YTRVLVDVDMSRQLFDSVIVEREGYAFYVSVQYERKPPFCSHCKFIGHTIQQCKK 157 >ref|XP_003622919.1| hypothetical protein MTR_7g058320 [Medicago truncatula] gi|355497934|gb|AES79137.1| hypothetical protein MTR_7g058320 [Medicago truncatula] Length = 266 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/56 (42%), Positives = 35/56 (62%) Frame = -3 Query: 380 QYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKK 213 QY ++LVD+D +H +L+ Y F+++V YE LPD C C +IGH + CKK Sbjct: 125 QYVRVLVDMDLSHTIRYKLLVERKWYAFFIEVDYENLPDYCSNCKAIGHYVEICKK 180 >ref|XP_003592213.1| hypothetical protein MTR_1g100160 [Medicago truncatula] gi|355481261|gb|AES62464.1| hypothetical protein MTR_1g100160 [Medicago truncatula] Length = 651 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/54 (42%), Positives = 38/54 (70%) Frame = -3 Query: 377 YAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 216 YA+IL+D+D + + I++ G+ F+V+V YE+LP+ C+ C +IGH+I CK Sbjct: 44 YARILIDLDLSKRIFNEIMVEREGFSFYVEVQYEQLPEYCNNCATIGHSIGQCK 97 >ref|XP_003614993.1| hypothetical protein MTR_5g062140 [Medicago truncatula] gi|355516328|gb|AES97951.1| hypothetical protein MTR_5g062140 [Medicago truncatula] Length = 449 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 9/87 (10%) Frame = -3 Query: 377 YAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANC------- 219 YA+ILVD+D++ + I + GY F ++V YE LPD C C +IGH + C Sbjct: 134 YARILVDMDFSRKLFHEIEVERQGYSFTLEVAYEWLPDFCSHCQNIGHDVTACRWLYPRK 193 Query: 218 --KKKEEQVVELSHEGPSGTINIVPFR 144 KK +EQ + + P+ VP + Sbjct: 194 ETKKHKEQTAQGKKQVPANKDTWVPIK 220 >ref|XP_003600952.1| hypothetical protein MTR_3g071380 [Medicago truncatula] gi|355490000|gb|AES71203.1| hypothetical protein MTR_3g071380 [Medicago truncatula] Length = 477 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -3 Query: 380 QYAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCK 216 QYA++LVD+D N+L+ GY F+V++ YE LPD C C IGH + C+ Sbjct: 220 QYARVLVDMDITKDLRYNVLVERKGYAFFVELEYENLPDYCVHCKKIGHDVEICR 274 >ref|XP_003614149.1| hypothetical protein MTR_5g045440 [Medicago truncatula] gi|355515484|gb|AES97107.1| hypothetical protein MTR_5g045440 [Medicago truncatula] Length = 720 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 11/89 (12%) Frame = -3 Query: 377 YAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANC------K 216 YA+ILVD+D+ + I++ G+ F V+V YER+PD C C +IGH I+ C K Sbjct: 209 YARILVDMDFTRKLFYEIVVEREGFAFPVEVVYERMPDFCTHCQNIGHHISVCRWIHPRK 268 Query: 215 KKE-----EQVVELSHEGPSGTINIVPFR 144 +KE E+V + + P+ VP + Sbjct: 269 EKENNTEKEKVAQGKKQMPTQRTEWVPLK 297 >ref|XP_003620991.1| Histone H4 [Medicago truncatula] gi|355496006|gb|AES77209.1| Histone H4 [Medicago truncatula] Length = 351 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/72 (36%), Positives = 41/72 (56%) Frame = -3 Query: 377 YAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKKKEEQV 198 YA+IL+D+D + N+L+ F+VK+ YE+ P C+ C I H+I NCKK + Sbjct: 131 YARILIDLDLSQPILNNLLVGREESAFFVKIEYEKQPLFCNNCKHIRHSIQNCKKIAQNS 190 Query: 197 VELSHEGPSGTI 162 ++L E T+ Sbjct: 191 IDLFKENKENTV 202 >gb|ABN09786.1| Histone H4; Histone-fold [Medicago truncatula] Length = 289 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/72 (36%), Positives = 41/72 (56%) Frame = -3 Query: 377 YAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKKKEEQV 198 YA+IL+D+D + N+L+ F+VK+ YE+ P C+ C I H+I NCKK + Sbjct: 88 YARILIDLDLSQPILNNLLVGREESAFFVKIEYEKQPLFCNNCKHIRHSIQNCKKIAQNS 147 Query: 197 VELSHEGPSGTI 162 ++L E T+ Sbjct: 148 IDLFKENKENTV 159 >ref|XP_003598300.1| hypothetical protein MTR_3g010070 [Medicago truncatula] gi|355487348|gb|AES68551.1| hypothetical protein MTR_3g010070 [Medicago truncatula] Length = 474 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/55 (41%), Positives = 36/55 (65%) Frame = -3 Query: 377 YAQILVDIDYNHQQTMNILI*ISGYKFWVKVFYERLPDLCDRCLSIGHTIANCKK 213 YA+ILVD+D++H+ I++ GY F V+V YE + D C C +IGH + C++ Sbjct: 194 YARILVDMDFSHKLFHEIIVEREGYAFTVEVAYEWMSDYCSHCQNIGHDVTACRR 248