BLASTX nr result
ID: Paeonia22_contig00029195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00029195 (532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320103.1| SHRUNKEN SEED 1 family protein [Populus tric... 87 3e-15 ref|XP_002302555.2| hypothetical protein POPTR_0002s15370g [Popu... 85 9e-15 ref|XP_006386584.1| hypothetical protein POPTR_0002s15370g [Popu... 85 9e-15 ref|XP_004510890.1| PREDICTED: peroxisome biogenesis protein 16-... 85 9e-15 ref|XP_007051962.1| Shrunken seed protein (SSE1) [Theobroma caca... 85 1e-14 ref|XP_002272931.2| PREDICTED: peroxisome biogenesis protein 16-... 84 2e-14 ref|XP_007219106.1| hypothetical protein PRUPE_ppa015596mg [Prun... 84 3e-14 ref|XP_007134949.1| hypothetical protein PHAVU_010G089200g [Phas... 83 4e-14 ref|XP_004306862.1| PREDICTED: peroxisome biogenesis protein 16-... 83 5e-14 gb|EXC11737.1| hypothetical protein L484_020792 [Morus notabilis] 82 6e-14 ref|XP_006445190.1| hypothetical protein CICLE_v10020702mg [Citr... 82 6e-14 ref|XP_006445188.1| hypothetical protein CICLE_v10020702mg [Citr... 82 6e-14 ref|XP_003521407.1| PREDICTED: peroxisome biogenesis protein 16-... 82 6e-14 emb|CAN81090.1| hypothetical protein VITISV_040910 [Vitis vinifera] 82 8e-14 ref|XP_006857955.1| hypothetical protein AMTR_s00069p00169360 [A... 80 3e-13 ref|XP_004144990.1| PREDICTED: peroxisome biogenesis protein 16-... 79 7e-13 gb|EYU32036.1| hypothetical protein MIMGU_mgv1a009226mg [Mimulus... 79 9e-13 gb|EPS70344.1| hypothetical protein M569_04416 [Genlisea aurea] 77 2e-12 ref|XP_006397749.1| hypothetical protein EUTSA_v10001499mg [Eutr... 77 3e-12 ref|XP_006397748.1| hypothetical protein EUTSA_v10001499mg [Eutr... 77 3e-12 >ref|XP_002320103.1| SHRUNKEN SEED 1 family protein [Populus trichocarpa] gi|222860876|gb|EEE98418.1| SHRUNKEN SEED 1 family protein [Populus trichocarpa] Length = 357 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVR+NKDYVHSLESLANGLTWLLPERFSASEIGPEA Sbjct: 1 MEAYKKWVRRNKDYVHSLESLANGLTWLLPERFSASEIGPEA 42 >ref|XP_002302555.2| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] gi|550345077|gb|EEE81828.2| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] Length = 385 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 ME YK WVR+NKDYVHSLESLANGLTWLLPERFSASEIGPEA Sbjct: 1 METYKKWVRRNKDYVHSLESLANGLTWLLPERFSASEIGPEA 42 >ref|XP_006386584.1| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] gi|550345076|gb|ERP64381.1| hypothetical protein POPTR_0002s15370g [Populus trichocarpa] Length = 361 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 ME YK WVR+NKDYVHSLESLANGLTWLLPERFSASEIGPEA Sbjct: 1 METYKKWVRRNKDYVHSLESLANGLTWLLPERFSASEIGPEA 42 >ref|XP_004510890.1| PREDICTED: peroxisome biogenesis protein 16-like [Cicer arietinum] Length = 355 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVR+NKDYVHSLESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MEAYKRWVRENKDYVHSLESLANGLTWLLPERFSESEIGPEA 42 >ref|XP_007051962.1| Shrunken seed protein (SSE1) [Theobroma cacao] gi|508704223|gb|EOX96119.1| Shrunken seed protein (SSE1) [Theobroma cacao] Length = 365 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYKTWVR+N+DYVHSLESLANGLTW LPERFS SEIGPEA Sbjct: 1 MEAYKTWVRRNRDYVHSLESLANGLTWFLPERFSTSEIGPEA 42 >ref|XP_002272931.2| PREDICTED: peroxisome biogenesis protein 16-like [Vitis vinifera] gi|296089132|emb|CBI38835.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVR+N+DYVHSLESLANGLTWLLPERFS+SEIGPEA Sbjct: 1 MEAYKKWVRRNRDYVHSLESLANGLTWLLPERFSSSEIGPEA 42 >ref|XP_007219106.1| hypothetical protein PRUPE_ppa015596mg [Prunus persica] gi|462415568|gb|EMJ20305.1| hypothetical protein PRUPE_ppa015596mg [Prunus persica] Length = 366 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVR+NKDYVHSLESLANG TWLLPERFS SEIGPEA Sbjct: 1 MEAYKKWVRENKDYVHSLESLANGFTWLLPERFSESEIGPEA 42 >ref|XP_007134949.1| hypothetical protein PHAVU_010G089200g [Phaseolus vulgaris] gi|561007994|gb|ESW06943.1| hypothetical protein PHAVU_010G089200g [Phaseolus vulgaris] Length = 365 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVRQNK++VHSLESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MEAYKRWVRQNKEFVHSLESLANGLTWLLPERFSESEIGPEA 42 >ref|XP_004306862.1| PREDICTED: peroxisome biogenesis protein 16-like [Fragaria vesca subsp. vesca] Length = 367 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVR+NK+YVHSLESLANG+TWLLPERFS SEIGPEA Sbjct: 1 MEAYKRWVRENKEYVHSLESLANGITWLLPERFSESEIGPEA 42 >gb|EXC11737.1| hypothetical protein L484_020792 [Morus notabilis] Length = 535 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVR+NKDYV SLESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MEAYKRWVRENKDYVQSLESLANGLTWLLPERFSTSEIGPEA 42 >ref|XP_006445190.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] gi|568875798|ref|XP_006490977.1| PREDICTED: peroxisome biogenesis protein 16-like [Citrus sinensis] gi|557547452|gb|ESR58430.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] Length = 369 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 M+AYK WVR+N+DYVHSLESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MDAYKRWVRRNRDYVHSLESLANGLTWLLPERFSESEIGPEA 42 >ref|XP_006445188.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] gi|557547450|gb|ESR58428.1| hypothetical protein CICLE_v10020702mg [Citrus clementina] Length = 323 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 M+AYK WVR+N+DYVHSLESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MDAYKRWVRRNRDYVHSLESLANGLTWLLPERFSESEIGPEA 42 >ref|XP_003521407.1| PREDICTED: peroxisome biogenesis protein 16-like [Glycine max] Length = 366 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVRQNK++VHS+ESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MEAYKRWVRQNKEFVHSMESLANGLTWLLPERFSESEIGPEA 42 >emb|CAN81090.1| hypothetical protein VITISV_040910 [Vitis vinifera] Length = 1109 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 394 VSESMEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 VS+ AYK WVR+N+DYVHSLESLANGLTWLLPERFS+SEIGPEA Sbjct: 741 VSKKHWAYKKWVRRNRDYVHSLESLANGLTWLLPERFSSSEIGPEA 786 >ref|XP_006857955.1| hypothetical protein AMTR_s00069p00169360 [Amborella trichopoda] gi|548862057|gb|ERN19422.1| hypothetical protein AMTR_s00069p00169360 [Amborella trichopoda] Length = 258 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WVR+N++YVHSLESLANGLTW LPERFSASEI PEA Sbjct: 1 MEAYKQWVRKNREYVHSLESLANGLTWFLPERFSASEIAPEA 42 >ref|XP_004144990.1| PREDICTED: peroxisome biogenesis protein 16-like [Cucumis sativus] gi|449471226|ref|XP_004153246.1| PREDICTED: peroxisome biogenesis protein 16-like [Cucumis sativus] gi|449522488|ref|XP_004168258.1| PREDICTED: peroxisome biogenesis protein 16-like [Cucumis sativus] Length = 369 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAY+ WVR N+DY+HS ESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MEAYRKWVRDNRDYLHSFESLANGLTWLLPERFSDSEIGPEA 42 >gb|EYU32036.1| hypothetical protein MIMGU_mgv1a009226mg [Mimulus guttatus] Length = 349 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 ME YK +VR+NKDYVHSLESLANGLTWLLPERFS SEIGPEA Sbjct: 1 MEYYKRFVRRNKDYVHSLESLANGLTWLLPERFSESEIGPEA 42 >gb|EPS70344.1| hypothetical protein M569_04416 [Genlisea aurea] Length = 355 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK W+ +N+DYVHSL SLANGLTWLLPERFS SEIGPEA Sbjct: 1 MEAYKRWLLRNRDYVHSLNSLANGLTWLLPERFSDSEIGPEA 42 >ref|XP_006397749.1| hypothetical protein EUTSA_v10001499mg [Eutrema salsugineum] gi|557098822|gb|ESQ39202.1| hypothetical protein EUTSA_v10001499mg [Eutrema salsugineum] Length = 367 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WV +N++YVHSL SLANGLTWLLPE+FSASEIGPEA Sbjct: 1 MEAYKQWVCRNREYVHSLGSLANGLTWLLPEKFSASEIGPEA 42 >ref|XP_006397748.1| hypothetical protein EUTSA_v10001499mg [Eutrema salsugineum] gi|557098821|gb|ESQ39201.1| hypothetical protein EUTSA_v10001499mg [Eutrema salsugineum] Length = 374 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 406 MEAYKTWVRQNKDYVHSLESLANGLTWLLPERFSASEIGPEA 531 MEAYK WV +N++YVHSL SLANGLTWLLPE+FSASEIGPEA Sbjct: 1 MEAYKQWVCRNREYVHSLGSLANGLTWLLPEKFSASEIGPEA 42