BLASTX nr result
ID: Paeonia22_contig00028992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00028992 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045571.1| Leucine-rich repeat protein kinase family pr... 60 3e-07 >ref|XP_007045571.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] gi|590697912|ref|XP_007045572.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] gi|590697916|ref|XP_007045573.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] gi|508709506|gb|EOY01403.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] gi|508709507|gb|EOY01404.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] gi|508709508|gb|EOY01405.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] Length = 669 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 309 MELLVSRYTHFFFFACVALVPMV--VRSGDAEALQSLKSSIDPVNSLPW 449 ME LVSRY FFF +L+ +V VRSGDAEAL +LKSSIDP NSLPW Sbjct: 1 MEPLVSRYYLLFFFIFCSLLSLVPLVRSGDAEALLTLKSSIDPFNSLPW 49