BLASTX nr result
ID: Paeonia22_contig00028657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00028657 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278220.1| PREDICTED: uncharacterized protein LOC100260... 61 1e-07 ref|XP_007020840.1| Expression of the gene is downregulated in t... 60 2e-07 gb|EYU19259.1| hypothetical protein MIMGU_mgv1a016350mg [Mimulus... 56 4e-06 ref|XP_003600083.1| hypothetical protein MTR_3g051570 [Medicago ... 56 4e-06 ref|XP_003600081.1| hypothetical protein MTR_3g051530 [Medicago ... 56 6e-06 ref|XP_007146469.1| hypothetical protein PHAVU_006G043100g [Phas... 55 8e-06 ref|XP_003600087.1| hypothetical protein MTR_3g051610 [Medicago ... 55 8e-06 >ref|XP_002278220.1| PREDICTED: uncharacterized protein LOC100260689 [Vitis vinifera] Length = 125 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 193 QFEELLNRVEIQGLSVQQVLAQLMDVRDGFSKEEGTWRPALKSIPEM 53 Q EELL +V++QGL+V QVL LM+V D F E+ +WRPAL+SIPE+ Sbjct: 78 QLEELLGKVDVQGLTVHQVLQHLMNVSDRFETEQRSWRPALQSIPEV 124 >ref|XP_007020840.1| Expression of the gene is downregulated in the presence of paraquat, putative [Theobroma cacao] gi|508720468|gb|EOY12365.1| Expression of the gene is downregulated in the presence of paraquat, putative [Theobroma cacao] Length = 127 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -1 Query: 193 QFEELLNRVEIQGLSVQQVLAQLMDVRDGFSKEEGTWRPALKSIPEM 53 Q EELL RV+++ LSVQQVLAQL++VR+ + + +WRPAL+SIPE+ Sbjct: 80 QLEELLGRVDVKELSVQQVLAQLINVRNQYETSQRSWRPALQSIPEV 126 >gb|EYU19259.1| hypothetical protein MIMGU_mgv1a016350mg [Mimulus guttatus] Length = 124 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -1 Query: 193 QFEELLNRVEIQGLSVQQVLAQLMDVRDGFSKEEGTWRPALKSIPE 56 Q E LL + +++GLS +QVLAQLM+V D + +W+PALKSIPE Sbjct: 79 QLETLLKKADVEGLSTEQVLAQLMNVADQLEAHQRSWKPALKSIPE 124 >ref|XP_003600083.1| hypothetical protein MTR_3g051570 [Medicago truncatula] gi|355489131|gb|AES70334.1| hypothetical protein MTR_3g051570 [Medicago truncatula] Length = 101 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -1 Query: 193 QFEELLNRVEIQGLSVQQVLAQLMDVRDGFSKEEGTWRPALKSIPEM 53 Q EELL++V+I+ L V+QVLAQLM+ +G+ + +WRPAL+SIPE+ Sbjct: 54 QLEELLSKVDIRELRVEQVLAQLMNHSNGYESLQRSWRPALQSIPEL 100 >ref|XP_003600081.1| hypothetical protein MTR_3g051530 [Medicago truncatula] gi|355489129|gb|AES70332.1| hypothetical protein MTR_3g051530 [Medicago truncatula] Length = 99 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -1 Query: 193 QFEELLNRVEIQGLSVQQVLAQLMDVRDGFSKEEGTWRPALKSIPEM 53 Q EELL++V+I+ L V+QVLAQLM+ +G+ + +WRPAL+SIPE+ Sbjct: 52 QLEELLSKVDIRELRVEQVLAQLMNHSNGYQSLQRSWRPALQSIPEV 98 >ref|XP_007146469.1| hypothetical protein PHAVU_006G043100g [Phaseolus vulgaris] gi|561019692|gb|ESW18463.1| hypothetical protein PHAVU_006G043100g [Phaseolus vulgaris] Length = 94 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -1 Query: 193 QFEELLNRVEIQGLSVQQVLAQLMDVRDGFSKEEGTWRPALKSIPE 56 Q EELL++V+++ L V+QVL+QLMD GF + WRPAL+SIPE Sbjct: 47 QLEELLSKVDVRELKVEQVLSQLMDHSGGFQTLQRPWRPALQSIPE 92 >ref|XP_003600087.1| hypothetical protein MTR_3g051610 [Medicago truncatula] gi|355489135|gb|AES70338.1| hypothetical protein MTR_3g051610 [Medicago truncatula] gi|388500484|gb|AFK38308.1| unknown [Medicago truncatula] Length = 97 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -1 Query: 193 QFEELLNRVEIQGLSVQQVLAQLMDVRDGFSKEEGTWRPALKSIPE 56 Q EELL++V+I+ L V+QVLAQLM+ +G+ + +WRPAL+SIPE Sbjct: 50 QLEELLSKVDIKELRVEQVLAQLMNHSNGYESLQRSWRPALQSIPE 95