BLASTX nr result
ID: Paeonia22_contig00028447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00028447 (1531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006293952.1| hypothetical protein CARUB_v10022943mg [Caps... 64 2e-07 ref|XP_006403694.1| hypothetical protein EUTSA_v10010255mg [Eutr... 64 2e-07 ref|XP_007027301.1| Transducin/WD40 repeat-like superfamily prot... 63 4e-07 ref|XP_006410895.1| hypothetical protein EUTSA_v10016480mg [Eutr... 62 5e-07 ref|XP_006292269.1| hypothetical protein CARUB_v10018478mg [Caps... 62 5e-07 ref|NP_190907.2| transducin/WD40 domain-containing protein [Arab... 62 5e-07 ref|XP_002876203.1| transducin family protein [Arabidopsis lyrat... 62 5e-07 ref|XP_006361813.1| PREDICTED: probable catabolite repression pr... 62 9e-07 ref|XP_004246664.1| PREDICTED: probable catabolite repression pr... 62 9e-07 ref|XP_004148769.1| PREDICTED: dystrophia myotonica WD repeat-co... 61 1e-06 ref|NP_181253.2| transducin/WD-40 repeat-containing protein [Ara... 61 2e-06 ref|NP_001031501.2| transducin/WD-40 repeat-containing protein [... 61 2e-06 ref|XP_002879654.1| nucleotide binding protein [Arabidopsis lyra... 61 2e-06 ref|XP_006480612.1| PREDICTED: WD repeat-containing protein 20-l... 60 3e-06 ref|XP_003625618.1| WD repeat-containing protein [Medicago trunc... 60 3e-06 ref|XP_003625617.1| WD repeat-containing protein [Medicago trunc... 60 3e-06 ref|XP_004304419.1| PREDICTED: probable catabolite repression pr... 60 3e-06 ref|XP_006588777.1| PREDICTED: WD repeat-containing protein 20-l... 59 4e-06 ref|XP_007162742.1| hypothetical protein PHAVU_001G176500g [Phas... 59 4e-06 ref|XP_004249575.1| PREDICTED: probable catabolite repression pr... 59 4e-06 >ref|XP_006293952.1| hypothetical protein CARUB_v10022943mg [Capsella rubella] gi|482562660|gb|EOA26850.1| hypothetical protein CARUB_v10022943mg [Capsella rubella] Length = 545 Score = 63.9 bits (154), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSIAWVPGSDG+FVVAHADGNLYV Sbjct: 232 VNNSRCTSIAWVPGSDGSFVVAHADGNLYV 261 >ref|XP_006403694.1| hypothetical protein EUTSA_v10010255mg [Eutrema salsugineum] gi|567187049|ref|XP_006403695.1| hypothetical protein EUTSA_v10010255mg [Eutrema salsugineum] gi|567187053|ref|XP_006403696.1| hypothetical protein EUTSA_v10010255mg [Eutrema salsugineum] gi|557104813|gb|ESQ45147.1| hypothetical protein EUTSA_v10010255mg [Eutrema salsugineum] gi|557104814|gb|ESQ45148.1| hypothetical protein EUTSA_v10010255mg [Eutrema salsugineum] gi|557104815|gb|ESQ45149.1| hypothetical protein EUTSA_v10010255mg [Eutrema salsugineum] Length = 558 Score = 63.5 bits (153), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSIAWVPG DGAFVVAHADGNLYV Sbjct: 232 VNNSRCTSIAWVPGGDGAFVVAHADGNLYV 261 >ref|XP_007027301.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] gi|508715906|gb|EOY07803.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 552 Score = 62.8 bits (151), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSIAWVPG DGAFVVAHADGN+YV Sbjct: 232 VNNSRCTSIAWVPGGDGAFVVAHADGNMYV 261 >ref|XP_006410895.1| hypothetical protein EUTSA_v10016480mg [Eutrema salsugineum] gi|557112064|gb|ESQ52348.1| hypothetical protein EUTSA_v10016480mg [Eutrema salsugineum] Length = 543 Score = 62.4 bits (150), Expect = 5e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSIAWVPG DG+FVVAHADGNLYV Sbjct: 233 VNNSRCTSIAWVPGGDGSFVVAHADGNLYV 262 >ref|XP_006292269.1| hypothetical protein CARUB_v10018478mg [Capsella rubella] gi|482560976|gb|EOA25167.1| hypothetical protein CARUB_v10018478mg [Capsella rubella] Length = 561 Score = 62.4 bits (150), Expect = 5e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSI+WVPG DGAFVVAHADGNLYV Sbjct: 232 VNNSRCTSISWVPGGDGAFVVAHADGNLYV 261 >ref|NP_190907.2| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332645558|gb|AEE79079.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 558 Score = 62.4 bits (150), Expect = 5e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSI+WVPG DGAFVVAHADGNLYV Sbjct: 232 VNNSRCTSISWVPGGDGAFVVAHADGNLYV 261 >ref|XP_002876203.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297322041|gb|EFH52462.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 558 Score = 62.4 bits (150), Expect = 5e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSI+WVPG DGAFVVAHADGNLYV Sbjct: 232 VNNSRCTSISWVPGGDGAFVVAHADGNLYV 261 >ref|XP_006361813.1| PREDICTED: probable catabolite repression protein creC-like [Solanum tuberosum] Length = 551 Score = 61.6 bits (148), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1438 LVSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 +V+NSRCTSIAWVP SDGAFVVAHADGN YV Sbjct: 232 VVNNSRCTSIAWVPNSDGAFVVAHADGNFYV 262 >ref|XP_004246664.1| PREDICTED: probable catabolite repression protein creC-like [Solanum lycopersicum] Length = 551 Score = 61.6 bits (148), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1438 LVSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 +V+NSRCTSIAWVP SDGAFVVAHADGN YV Sbjct: 232 VVNNSRCTSIAWVPNSDGAFVVAHADGNFYV 262 >ref|XP_004148769.1| PREDICTED: dystrophia myotonica WD repeat-containing protein-like [Cucumis sativus] gi|449517599|ref|XP_004165833.1| PREDICTED: dystrophia myotonica WD repeat-containing protein-like [Cucumis sativus] Length = 568 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTS+AW+P SDGAFVVAHADGNLYV Sbjct: 253 VNNSRCTSVAWIPKSDGAFVVAHADGNLYV 282 >ref|NP_181253.2| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|330254266|gb|AEC09360.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Length = 544 Score = 60.8 bits (146), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSIAWVPG DG+FV AHADGNLYV Sbjct: 232 VNNSRCTSIAWVPGGDGSFVAAHADGNLYV 261 >ref|NP_001031501.2| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|330254267|gb|AEC09361.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Length = 573 Score = 60.8 bits (146), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSIAWVPG DG+FV AHADGNLYV Sbjct: 261 VNNSRCTSIAWVPGGDGSFVAAHADGNLYV 290 >ref|XP_002879654.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata] gi|297325493|gb|EFH55913.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata] Length = 540 Score = 60.8 bits (146), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTSIAWVPG DG+FV AHADGNLYV Sbjct: 229 VNNSRCTSIAWVPGGDGSFVAAHADGNLYV 258 >ref|XP_006480612.1| PREDICTED: WD repeat-containing protein 20-like [Citrus sinensis] Length = 548 Score = 60.1 bits (144), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCTS+ WVPG DGAFVV HADGNLYV Sbjct: 228 VNNSRCTSVTWVPGGDGAFVVGHADGNLYV 257 >ref|XP_003625618.1| WD repeat-containing protein [Medicago truncatula] gi|355500633|gb|AES81836.1| WD repeat-containing protein [Medicago truncatula] Length = 383 Score = 60.1 bits (144), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1438 LVSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 +++NSRCT I+WVPG DGAFVVAHADGNLYV Sbjct: 226 ILNNSRCTCISWVPGGDGAFVVAHADGNLYV 256 >ref|XP_003625617.1| WD repeat-containing protein [Medicago truncatula] gi|355500632|gb|AES81835.1| WD repeat-containing protein [Medicago truncatula] Length = 552 Score = 60.1 bits (144), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1438 LVSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 +++NSRCT I+WVPG DGAFVVAHADGNLYV Sbjct: 226 ILNNSRCTCISWVPGGDGAFVVAHADGNLYV 256 >ref|XP_004304419.1| PREDICTED: probable catabolite repression protein creC-like [Fragaria vesca subsp. vesca] Length = 550 Score = 59.7 bits (143), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 VS SRCTS+AWVPG DG+FVVAHADGNLYV Sbjct: 230 VSISRCTSVAWVPGGDGSFVVAHADGNLYV 259 >ref|XP_006588777.1| PREDICTED: WD repeat-containing protein 20-like isoform X2 [Glycine max] Length = 576 Score = 59.3 bits (142), Expect = 4e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCT IAWVPG D AFVVAHADGNLYV Sbjct: 233 VNNSRCTCIAWVPGGDAAFVVAHADGNLYV 262 >ref|XP_007162742.1| hypothetical protein PHAVU_001G176500g [Phaseolus vulgaris] gi|561036206|gb|ESW34736.1| hypothetical protein PHAVU_001G176500g [Phaseolus vulgaris] Length = 551 Score = 59.3 bits (142), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 V+NSRCT IAWVPG DGAFVV+H+DGNLYV Sbjct: 227 VNNSRCTCIAWVPGGDGAFVVSHSDGNLYV 256 >ref|XP_004249575.1| PREDICTED: probable catabolite repression protein creC-like [Solanum lycopersicum] Length = 555 Score = 59.3 bits (142), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1441 VSNSRCTSIAWVPGSDGAFVVAHADGNLYV 1530 ++NSRCTSI WVP SDGAFVVAHADGN YV Sbjct: 235 INNSRCTSITWVPNSDGAFVVAHADGNFYV 264