BLASTX nr result
ID: Paeonia22_contig00028315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00028315 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297409.1| PREDICTED: probable receptor protein kinase ... 55 8e-06 >ref|XP_004297409.1| PREDICTED: probable receptor protein kinase TMK1-like [Fragaria vesca subsp. vesca] Length = 890 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +1 Query: 61 VEYCTALKNDKFIHHDLKPLNILFGDNMTAKVAYFGLARVVSNERSSAE 207 VEY L N+ FIH DLKP NIL GD+M AKVA FGL R+ ++S E Sbjct: 649 VEYLHGLANEIFIHRDLKPSNILLGDDMRAKVADFGLVRLAPAGKASIE 697