BLASTX nr result
ID: Paeonia22_contig00028265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00028265 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESZ98761.1| hypothetical protein SBOR_0867 [Sclerotinia borea... 60 4e-07 ref|XP_001560073.1| hypothetical protein BC1G_01632 [Botryotinia... 60 4e-07 >gb|ESZ98761.1| hypothetical protein SBOR_0867 [Sclerotinia borealis F-4157] Length = 299 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/72 (44%), Positives = 44/72 (61%) Frame = +1 Query: 22 SSSPEHHVSTKQHKGKEAKDKIVSESSKGAGKVDYAEAEEKERKNSERQSEKEGDARRSA 201 ++ + H S K KGKE KDKI SE K AGKV +A+A+E+E KN Q+EKE DAR + Sbjct: 228 TAEEKRHSSGKMAKGKENKDKISSEM-KSAGKVAFADAKEREDKNQAEQAEKEADARNES 286 Query: 202 TADGAKVQDRGE 237 ++ R + Sbjct: 287 AQAEPQINGRNQ 298 >ref|XP_001560073.1| hypothetical protein BC1G_01632 [Botryotinia fuckeliana B05.10] gi|347831008|emb|CCD46705.1| hypothetical protein BofuT4_P043160.1 [Botryotinia fuckeliana T4] gi|472244825|gb|EMR89427.1| putative mitochondrial hypoxia responsive domain-containing protein [Botryotinia fuckeliana BcDW1] Length = 299 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = +1 Query: 37 HHVSTKQHKGKEAKDKIVSESSKGAGKVDYAEAEEKERKNSERQSEKEGDARRSATADGA 216 +H S K GKE KDKI SE K AGKV +A+A+E+E KN Q+EKE DA+ +T Sbjct: 233 NHSSGKTSSGKENKDKISSEM-KSAGKVAFADAQEREDKNQAEQAEKEADAKHESTQSEP 291 Query: 217 KVQDRGE 237 KV + + Sbjct: 292 KVNGKNK 298