BLASTX nr result
ID: Paeonia22_contig00028261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00028261 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO35357.1| Acyl-CoA dehydrogenase [Elaeis oleifera] 62 8e-08 gb|EXC02107.1| Peroxisomal acyl-coenzyme A oxidase 1 [Morus nota... 59 7e-07 ref|XP_004299412.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 58 1e-06 ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prun... 57 3e-06 ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus tri... 56 4e-06 gb|EXC02108.1| Peroxisomal acyl-coenzyme A oxidase 1 [Morus nota... 56 6e-06 ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis... 55 8e-06 >gb|ACO35357.1| Acyl-CoA dehydrogenase [Elaeis oleifera] Length = 212 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 160 MEEVDHLAHERIKAQFDVDAMKIVWAGSRH 249 MEEVDHLAHER KAQFDVDAMK+VWAGS+H Sbjct: 1 MEEVDHLAHERSKAQFDVDAMKVVWAGSKH 30 >gb|EXC02107.1| Peroxisomal acyl-coenzyme A oxidase 1 [Morus notabilis] Length = 665 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 160 MEEVDHLAHERIKAQFDVDAMKIVWAGSRH 249 ME+VDHLAHER KAQFDV+ MKIVWAGSRH Sbjct: 1 MEDVDHLAHERSKAQFDVEEMKIVWAGSRH 30 >ref|XP_004299412.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Fragaria vesca subsp. vesca] Length = 664 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 160 MEEVDHLAHERIKAQFDVDAMKIVWAGSRH 249 ME VDHLAHER KAQFDVD MK+VWAGSRH Sbjct: 1 MEGVDHLAHERSKAQFDVDHMKVVWAGSRH 30 >ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] gi|402744131|gb|AFQ93693.1| acyl-CoA oxidase 1 [Prunus persica] gi|462406037|gb|EMJ11501.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] Length = 664 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 160 MEEVDHLAHERIKAQFDVDAMKIVWAGSRH 249 ME VDHLAHER KAQFDVD MK+VW GSRH Sbjct: 1 MEGVDHLAHERSKAQFDVDQMKVVWVGSRH 30 >ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550347354|gb|ERP65564.1| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 160 MEEVDHLAHERIKAQFDVDAMKIVWAGSRH 249 M+ VDHLAHER K +FDVDAMKIVWAGSRH Sbjct: 1 MKGVDHLAHERNKTEFDVDAMKIVWAGSRH 30 >gb|EXC02108.1| Peroxisomal acyl-coenzyme A oxidase 1 [Morus notabilis] Length = 718 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 160 MEEVDHLAHERIKAQFDVDAMKIVWAGSRH 249 ME VDHL HER KAQFDV+ MKIVWAGSRH Sbjct: 1 MEGVDHLTHERSKAQFDVEEMKIVWAGSRH 30 >ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis] gi|223535400|gb|EEF37074.1| acyl-CoA oxidase, putative [Ricinus communis] Length = 664 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 160 MEEVDHLAHERIKAQFDVDAMKIVWAGSRH 249 ME VDHLA ER KAQFDVD MKIVWAGSRH Sbjct: 1 MEGVDHLAEERNKAQFDVDEMKIVWAGSRH 30