BLASTX nr result
ID: Paeonia22_contig00027698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00027698 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447962.1| hypothetical protein CICLE_v10016664mg [Citr... 59 7e-07 ref|XP_006447966.1| hypothetical protein CICLE_v10018166mg [Citr... 57 3e-06 >ref|XP_006447962.1| hypothetical protein CICLE_v10016664mg [Citrus clementina] gi|568830068|ref|XP_006469335.1| PREDICTED: uncharacterized protein LOC102631008 [Citrus sinensis] gi|557550573|gb|ESR61202.1| hypothetical protein CICLE_v10016664mg [Citrus clementina] Length = 216 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +2 Query: 137 KAMDDIINVNSLFTVAVFVGLSAAGEKVRSLDGRPE 244 KA+DD++NVNSLFT+AVFVGLS A RSLDGRPE Sbjct: 41 KALDDLVNVNSLFTIAVFVGLSLASRNQRSLDGRPE 76 >ref|XP_006447966.1| hypothetical protein CICLE_v10018166mg [Citrus clementina] gi|557550577|gb|ESR61206.1| hypothetical protein CICLE_v10018166mg [Citrus clementina] Length = 215 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 137 KAMDDIINVNSLFTVAVFVGLSAAGEKVRSLDGRPE 244 KA+DD++NVNSLFT+AVFVGLS A RSL+GRPE Sbjct: 40 KALDDLVNVNSLFTIAVFVGLSFASRNQRSLEGRPE 75