BLASTX nr result
ID: Paeonia22_contig00027695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00027695 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001275146.1| uncharacterized protein LOC102585221 [Solanu... 79 9e-13 ref|NP_001234584.1| UCP protein [Solanum lycopersicum] gi|189210... 77 2e-12 ref|XP_007205615.1| hypothetical protein PRUPE_ppa009102mg [Prun... 77 3e-12 gb|EYU26638.1| hypothetical protein MIMGU_mgv1a0106722mg [Mimulu... 75 1e-11 ref|XP_004302662.1| PREDICTED: mitochondrial uncoupling protein ... 75 1e-11 ref|XP_007133969.1| hypothetical protein PHAVU_010G007800g [Phas... 75 1e-11 ref|XP_006429270.1| hypothetical protein CICLE_v10012294mg [Citr... 75 1e-11 gb|EPS59739.1| hypothetical protein M569_15066, partial [Genlise... 75 1e-11 ref|XP_003552220.1| PREDICTED: mitochondrial uncoupling protein ... 75 1e-11 ref|XP_002322953.1| UNCOUPLING family protein [Populus trichocar... 75 1e-11 ref|XP_004514487.1| PREDICTED: mitochondrial uncoupling protein ... 74 2e-11 ref|XP_004147893.1| PREDICTED: mitochondrial uncoupling protein ... 74 2e-11 ref|XP_007026812.1| Plant uncoupling mitochondrial protein 1 [Th... 74 3e-11 ref|XP_003529136.1| PREDICTED: mitochondrial uncoupling protein ... 74 3e-11 ref|NP_001241311.1| uncharacterized protein LOC100809667 [Glycin... 74 3e-11 ref|XP_002308202.1| UNCOUPLING family protein [Populus trichocar... 74 3e-11 gb|AFK43458.1| unknown [Lotus japonicus] 73 4e-11 ref|XP_002277421.1| PREDICTED: mitochondrial uncoupling protein ... 73 4e-11 ref|XP_002527871.1| mitochondrial uncoupling protein, putative [... 73 4e-11 emb|CAN64198.1| hypothetical protein VITISV_014339 [Vitis vinifera] 73 4e-11 >ref|NP_001275146.1| uncharacterized protein LOC102585221 [Solanum tuberosum] gi|2398829|emb|CAA72107.1| mitochondrial uncoupling protein [Solanum tuberosum] gi|6318246|emb|CAB60277.1| UCP [Solanum tuberosum] Length = 306 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIESP 217 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKS+ESP Sbjct: 270 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSLESP 306 >ref|NP_001234584.1| UCP protein [Solanum lycopersicum] gi|18921040|gb|AAL82482.1|AF472619_1 putative uncoupling protein [Solanum lycopersicum] Length = 306 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIESP 217 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVK++ESP Sbjct: 270 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKNLESP 306 >ref|XP_007205615.1| hypothetical protein PRUPE_ppa009102mg [Prunus persica] gi|462401257|gb|EMJ06814.1| hypothetical protein PRUPE_ppa009102mg [Prunus persica] Length = 306 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES Sbjct: 270 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 305 >gb|EYU26638.1| hypothetical protein MIMGU_mgv1a0106722mg [Mimulus guttatus] Length = 305 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV+S+ES Sbjct: 269 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVRSVES 304 >ref|XP_004302662.1| PREDICTED: mitochondrial uncoupling protein 1-like [Fragaria vesca subsp. vesca] Length = 307 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLT EQAKKFVKSIES Sbjct: 271 AFYKGFIPNFGRLGSWNVIMFLTFEQAKKFVKSIES 306 >ref|XP_007133969.1| hypothetical protein PHAVU_010G007800g [Phaseolus vulgaris] gi|561007014|gb|ESW05963.1| hypothetical protein PHAVU_010G007800g [Phaseolus vulgaris] Length = 305 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIESP 217 AFYKGF+PNFGRLGSWNVIMFLTLEQ KKF+K++ESP Sbjct: 269 AFYKGFLPNFGRLGSWNVIMFLTLEQTKKFIKNLESP 305 >ref|XP_006429270.1| hypothetical protein CICLE_v10012294mg [Citrus clementina] gi|568854672|ref|XP_006480945.1| PREDICTED: mitochondrial uncoupling protein 1-like [Citrus sinensis] gi|557531327|gb|ESR42510.1| hypothetical protein CICLE_v10012294mg [Citrus clementina] Length = 306 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGF+PNFGRLGSWNVIMFLTLEQAKKFV+SIES Sbjct: 269 AFYKGFLPNFGRLGSWNVIMFLTLEQAKKFVRSIES 304 >gb|EPS59739.1| hypothetical protein M569_15066, partial [Genlisea aurea] Length = 283 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIESP 217 AFYKGFIPNFGRLGSWNVIMFLTLEQAK FV+S ESP Sbjct: 241 AFYKGFIPNFGRLGSWNVIMFLTLEQAKSFVRSFESP 277 >ref|XP_003552220.1| PREDICTED: mitochondrial uncoupling protein 1-like [Glycine max] Length = 305 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVK++ES Sbjct: 269 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKTLES 304 >ref|XP_002322953.1| UNCOUPLING family protein [Populus trichocarpa] gi|222867583|gb|EEF04714.1| UNCOUPLING family protein [Populus trichocarpa] Length = 307 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV+S+ES Sbjct: 269 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVRSLES 304 >ref|XP_004514487.1| PREDICTED: mitochondrial uncoupling protein 1-like [Cicer arietinum] Length = 304 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQ KKFVKS+ES Sbjct: 268 AFYKGFIPNFGRLGSWNVIMFLTLEQTKKFVKSLES 303 >ref|XP_004147893.1| PREDICTED: mitochondrial uncoupling protein 1-like [Cucumis sativus] gi|449528798|ref|XP_004171390.1| PREDICTED: mitochondrial uncoupling protein 1-like [Cucumis sativus] Length = 304 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV++IES Sbjct: 267 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVRNIES 302 >ref|XP_007026812.1| Plant uncoupling mitochondrial protein 1 [Theobroma cacao] gi|508715417|gb|EOY07314.1| Plant uncoupling mitochondrial protein 1 [Theobroma cacao] Length = 305 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV+++ES Sbjct: 269 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVRNLES 304 >ref|XP_003529136.1| PREDICTED: mitochondrial uncoupling protein 1-like [Glycine max] Length = 305 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFY GFIPNFGRLGSWNVIMFLTLEQAKKFVKS+ES Sbjct: 269 AFYMGFIPNFGRLGSWNVIMFLTLEQAKKFVKSLES 304 >ref|NP_001241311.1| uncharacterized protein LOC100809667 [Glycine max] gi|255635380|gb|ACU18043.1| unknown [Glycine max] Length = 305 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGF+PNFGRLGSWNVIMFLTLEQ KKFVKS+ES Sbjct: 269 AFYKGFLPNFGRLGSWNVIMFLTLEQTKKFVKSLES 304 >ref|XP_002308202.1| UNCOUPLING family protein [Populus trichocarpa] gi|118483177|gb|ABK93493.1| unknown [Populus trichocarpa] gi|222854178|gb|EEE91725.1| UNCOUPLING family protein [Populus trichocarpa] Length = 305 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV+++ES Sbjct: 269 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVRNLES 304 >gb|AFK43458.1| unknown [Lotus japonicus] Length = 305 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFY+GFIPNFGRLGSWNVIMFLTLEQ KKFVKS+ES Sbjct: 269 AFYRGFIPNFGRLGSWNVIMFLTLEQTKKFVKSLES 304 >ref|XP_002277421.1| PREDICTED: mitochondrial uncoupling protein 3 [Vitis vinifera] gi|297740258|emb|CBI30440.3| unnamed protein product [Vitis vinifera] Length = 304 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV+ IES Sbjct: 268 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVQRIES 303 >ref|XP_002527871.1| mitochondrial uncoupling protein, putative [Ricinus communis] gi|223532722|gb|EEF34502.1| mitochondrial uncoupling protein, putative [Ricinus communis] Length = 305 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV+ +ES Sbjct: 269 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVRDLES 304 >emb|CAN64198.1| hypothetical protein VITISV_014339 [Vitis vinifera] Length = 304 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 327 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVKSIES 220 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFV+ IES Sbjct: 268 AFYKGFIPNFGRLGSWNVIMFLTLEQAKKFVQRIES 303