BLASTX nr result
ID: Paeonia22_contig00027622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00027622 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279354.2| PREDICTED: F-box protein At1g30790-like [Vit... 56 4e-07 >ref|XP_002279354.2| PREDICTED: F-box protein At1g30790-like [Vitis vinifera] Length = 244 Score = 56.2 bits (134), Expect(2) = 4e-07 Identities = 30/58 (51%), Positives = 38/58 (65%), Gaps = 9/58 (15%) Frame = -1 Query: 266 ECIISVAARANEIFIPT--------MDYETWKRVWLAA-LDGDFPVAFTYTESLLPCN 120 EC+ SVAAR NEIF T +DY+TW + +A + +FPVAF +TESLLPCN Sbjct: 182 ECVDSVAARKNEIFFITSAHYLVFNVDYKTWTELDIAGTFEENFPVAFAFTESLLPCN 239 Score = 23.5 bits (49), Expect(2) = 4e-07 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 340 IWILQDSDGLTWVEKCN 290 IW+L+D + W +KC+ Sbjct: 157 IWVLKDCNESIWEKKCS 173