BLASTX nr result
ID: Paeonia22_contig00027618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00027618 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264685.1| PREDICTED: APO protein 1, chloroplastic [Vit... 58 2e-06 >ref|XP_002264685.1| PREDICTED: APO protein 1, chloroplastic [Vitis vinifera] gi|297734690|emb|CBI16741.3| unnamed protein product [Vitis vinifera] Length = 444 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +1 Query: 256 MLELPPAVSYASWNPSQRGDSMGIMKFKRHQLLVLRSFTFGLK 384 ML+ PP +S ASWNPSQRG +GIM FKR +L RS+T GLK Sbjct: 1 MLQQPPVISPASWNPSQRGVCLGIMDFKRPKLSASRSYTLGLK 43