BLASTX nr result
ID: Paeonia22_contig00026887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00026887 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] 50 5e-06 >emb|CAN79019.1| hypothetical protein VITISV_043767 [Vitis vinifera] Length = 1070 Score = 50.1 bits (118), Expect(2) = 5e-06 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +2 Query: 137 FLWGLSH*KINTNDIWQKSEPWKILNLHWCCMCRVSKENQDHLFFSSSLAQRIW 298 F+W ++H K+NTND+ Q P+K L+ + C +C E+ DHLF L +W Sbjct: 909 FIWLVAHKKVNTNDLLQLRRPYKTLSPNICKLCMKHGESADHLFLRCYLTMGLW 962 Score = 25.8 bits (55), Expect(2) = 5e-06 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 33 VWTCKSFYL--SHSDSHIHTFSSNFV*NLSLPLKINFFCGAYLIKK 164 ++T KSF+L SH F +NFV N + K+ F KK Sbjct: 872 LFTVKSFFLALSHPSDLSPIFPTNFVWNFQVSFKVKSFIWLVAHKK 917