BLASTX nr result
ID: Paeonia22_contig00026859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00026859 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382364.1| hypothetical protein POPTR_0005s01450g, part... 112 4e-23 emb|CBI39619.3| unnamed protein product [Vitis vinifera] 110 2e-22 ref|XP_002277347.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 ref|XP_004500093.1| PREDICTED: pentatricopeptide repeat-containi... 109 4e-22 ref|XP_007137380.1| hypothetical protein PHAVU_009G122500g [Phas... 108 6e-22 ref|XP_007207552.1| hypothetical protein PRUPE_ppa017672mg [Prun... 108 1e-21 ref|XP_006472234.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_006433563.1| hypothetical protein CICLE_v10000386mg [Citr... 107 2e-21 ref|XP_006602194.1| PREDICTED: pentatricopeptide repeat-containi... 106 3e-21 gb|EXC31178.1| hypothetical protein L484_004944 [Morus notabilis] 105 5e-21 ref|XP_006344853.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_004304908.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 gb|EYU44038.1| hypothetical protein MIMGU_mgv1a001643mg [Mimulus... 102 7e-20 ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 97 2e-18 ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 97 2e-18 ref|XP_003633340.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 emb|CBI28420.3| unnamed protein product [Vitis vinifera] 97 2e-18 >ref|XP_006382364.1| hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] gi|550337723|gb|ERP60161.1| hypothetical protein POPTR_0005s01450g, partial [Populus trichocarpa] Length = 788 Score = 112 bits (281), Expect = 4e-23 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -2 Query: 367 PPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 PPTPIRI+KNLRICNDCH AKLISKAF REIVVRD+HRFHHFKQGSCSCMDYW Sbjct: 735 PPTPIRIVKNLRICNDCHTAAKLISKAFNREIVVRDRHRFHHFKQGSCSCMDYW 788 >emb|CBI39619.3| unnamed protein product [Vitis vinifera] Length = 640 Score = 110 bits (275), Expect = 2e-22 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PPTPIRIMKNLRICNDCH AKLISKA+ REIVVRD+HRFH+FK+G+CSCMDYW Sbjct: 584 TISPPTPIRIMKNLRICNDCHTAAKLISKAYAREIVVRDRHRFHYFKEGACSCMDYW 640 >ref|XP_002277347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 808 Score = 110 bits (275), Expect = 2e-22 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PPTPIRIMKNLRICNDCH AKLISKA+ REIVVRD+HRFH+FK+G+CSCMDYW Sbjct: 752 TISPPTPIRIMKNLRICNDCHTAAKLISKAYAREIVVRDRHRFHYFKEGACSCMDYW 808 >ref|XP_004500093.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X1 [Cicer arietinum] gi|502128825|ref|XP_004500094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X2 [Cicer arietinum] Length = 785 Score = 109 bits (272), Expect = 4e-22 Identities = 47/57 (82%), Positives = 50/57 (87%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PP PIRIMKNLRICNDCH V KLISKAF REIV+RD+HRFHHFK GSCSCMD+W Sbjct: 729 TIAPPAPIRIMKNLRICNDCHTVVKLISKAFDREIVIRDRHRFHHFKHGSCSCMDFW 785 >ref|XP_007137380.1| hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] gi|561010467|gb|ESW09374.1| hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] Length = 774 Score = 108 bits (271), Expect = 6e-22 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PPTPIR+MKNLRICNDCH V KLISKAF REIVVRD+HRFHHF+ G+CSCMD+W Sbjct: 718 TIAPPTPIRVMKNLRICNDCHTVVKLISKAFDREIVVRDRHRFHHFRHGACSCMDFW 774 >ref|XP_007207552.1| hypothetical protein PRUPE_ppa017672mg [Prunus persica] gi|462403194|gb|EMJ08751.1| hypothetical protein PRUPE_ppa017672mg [Prunus persica] Length = 745 Score = 108 bits (269), Expect = 1e-21 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -2 Query: 373 TYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PPTPIRI+KNLRICNDCH+ AK ISKAF R+IV+RD+HRFHHFKQGSCSC DYW Sbjct: 690 TSPPTPIRIIKNLRICNDCHMAAKFISKAFNRDIVLRDRHRFHHFKQGSCSCKDYW 745 >ref|XP_006472234.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Citrus sinensis] Length = 798 Score = 107 bits (266), Expect = 2e-21 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PP PIRIMKNLRICNDCH AK IS+AF REIVVRD+HRFHHFK GSCSCMD+W Sbjct: 742 TISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW 798 >ref|XP_006433563.1| hypothetical protein CICLE_v10000386mg [Citrus clementina] gi|557535685|gb|ESR46803.1| hypothetical protein CICLE_v10000386mg [Citrus clementina] Length = 746 Score = 107 bits (266), Expect = 2e-21 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PP PIRIMKNLRICNDCH AK IS+AF REIVVRD+HRFHHFK GSCSCMD+W Sbjct: 690 TISPPNPIRIMKNLRICNDCHTAAKFISRAFDREIVVRDRHRFHHFKHGSCSCMDFW 746 >ref|XP_006602194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like isoform X1 [Glycine max] Length = 775 Score = 106 bits (265), Expect = 3e-21 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T PPTPIR+ KNLRICNDCH V KLISKAF R+IVVRD+HRFHHFK G+CSCMD+W Sbjct: 719 TISPPTPIRVTKNLRICNDCHTVVKLISKAFDRDIVVRDRHRFHHFKHGACSCMDFW 775 >gb|EXC31178.1| hypothetical protein L484_004944 [Morus notabilis] Length = 745 Score = 105 bits (263), Expect = 5e-21 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -2 Query: 376 TTYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 +T PPTPIRIMKNLRICNDCH AK ISKA+ R IVVRD+HRFHHF QGSCSC+DYW Sbjct: 689 STSPPTPIRIMKNLRICNDCHNAAKFISKAYDRVIVVRDRHRFHHFDQGSCSCLDYW 745 >ref|XP_006344853.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Solanum tuberosum] Length = 745 Score = 105 bits (263), Expect = 5e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 367 PPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 PPTPIRI+KNLRIC+DCH AKLISKAF REIVVRD+HRFHHFK GSCSCM++W Sbjct: 692 PPTPIRIIKNLRICSDCHAAAKLISKAFDREIVVRDRHRFHHFKDGSCSCMEFW 745 >ref|XP_004304908.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 777 Score = 105 bits (263), Expect = 5e-21 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = -2 Query: 367 PPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 PP+PIRI+KNLRICNDCH+ AK +SKAF R+IVVRD+HRFHHFKQGSCSC DYW Sbjct: 724 PPSPIRIIKNLRICNDCHMAAKFVSKAFGRDIVVRDKHRFHHFKQGSCSCNDYW 777 >gb|EYU44038.1| hypothetical protein MIMGU_mgv1a001643mg [Mimulus guttatus] Length = 780 Score = 102 bits (253), Expect = 7e-20 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -2 Query: 373 TYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T P PIRI+KNLRIC DCH AKL+S+AF REIV+RD+HRFHHFK GSCSCMDYW Sbjct: 725 TSGPAPIRIIKNLRICGDCHAAAKLVSEAFDREIVIRDRHRFHHFKHGSCSCMDYW 780 >ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/56 (75%), Positives = 46/56 (82%) Frame = -2 Query: 373 TYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T P TPIRIMKNLR+C DCH+ KLISK F REI+VRD+ RFHHFK GSCSC DYW Sbjct: 554 TPPGTPIRIMKNLRVCADCHLAIKLISKVFEREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/56 (75%), Positives = 46/56 (82%) Frame = -2 Query: 373 TYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T P TPIRIMKNLR+C DCH+ KLISK F REI+VRD+ RFHHFK GSCSC DYW Sbjct: 554 TPPGTPIRIMKNLRVCADCHLAIKLISKVFEREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 97.1 bits (240), Expect = 2e-18 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -2 Query: 373 TYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T P TPIRI+KNLR+CNDCH K ISK + REIVVRD+HRFHHFK GSCSC D+W Sbjct: 511 TPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 97.1 bits (240), Expect = 2e-18 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -2 Query: 373 TYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T P TPIRI+KNLR+CNDCH K ISK + REIVVRD+HRFHHFK GSCSC D+W Sbjct: 545 TPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 600 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 97.1 bits (240), Expect = 2e-18 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = -2 Query: 373 TYPPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 T P TPIRI+KNLR+CNDCH K ISK + REIVVRD+HRFHHFK GSCSC D+W Sbjct: 574 TPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 629 >ref|XP_003633340.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 679 Score = 97.1 bits (240), Expect = 2e-18 Identities = 41/54 (75%), Positives = 45/54 (83%) Frame = -2 Query: 367 PPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 P PIRIMKNLR+CNDCH V KL+SK + REI+VRD RFHHFK GSCSCMDYW Sbjct: 626 PGIPIRIMKNLRVCNDCHSVTKLLSKIYSREIIVRDNCRFHHFKNGSCSCMDYW 679 >emb|CBI28420.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 97.1 bits (240), Expect = 2e-18 Identities = 41/54 (75%), Positives = 45/54 (83%) Frame = -2 Query: 367 PPTPIRIMKNLRICNDCHVVAKLISKAFVREIVVRDQHRFHHFKQGSCSCMDYW 206 P PIRIMKNLR+CNDCH V KL+SK + REI+VRD RFHHFK GSCSCMDYW Sbjct: 578 PGIPIRIMKNLRVCNDCHSVTKLLSKIYSREIIVRDNCRFHHFKNGSCSCMDYW 631