BLASTX nr result
ID: Paeonia22_contig00026576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00026576 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_173793.1| paired amphipathic helix repeat-containing prot... 48 1e-06 >ref|NP_173793.1| paired amphipathic helix repeat-containing protein [Arabidopsis thaliana] gi|4056463|gb|AAC98036.1| F5O8.36 [Arabidopsis thaliana] gi|332192313|gb|AEE30434.1| paired amphipathic helix repeat-containing protein [Arabidopsis thaliana] Length = 241 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = -2 Query: 113 HDDEKKYKEFLIVLNDFKAQRITFAGVVARVKELFKE 3 HD+ KY+E L +LNDFKA+R+ A V+ARV+EL K+ Sbjct: 122 HDEPAKYEEMLKLLNDFKARRVNAASVIARVEELMKD 158 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 177 PTPTIEDSETYLKAVKGTFHE 115 P PTI+D+ +YL AVK FH+ Sbjct: 103 PEPTIDDATSYLIAVKEAFHD 123