BLASTX nr result
ID: Paeonia22_contig00026011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00026011 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus commun... 71 2e-10 ref|XP_004302361.1| PREDICTED: thioredoxin H2-like [Fragaria ves... 69 5e-10 gb|ABG81098.1| thioredoxin H [Pelargonium x hortorum] 68 1e-09 ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS... 67 2e-09 gb|ACU15762.1| unknown [Glycine max] 67 2e-09 ref|XP_003552507.1| PREDICTED: thioredoxin H2 [Glycine max] 67 3e-09 gb|EYU28689.1| hypothetical protein MIMGU_mgv1a023737mg [Mimulus... 67 3e-09 gb|EXB30121.1| Thioredoxin H2-2 [Morus notabilis] 67 3e-09 ref|XP_007139606.1| hypothetical protein PHAVU_008G044000g [Phas... 66 4e-09 ref|XP_007215973.1| hypothetical protein PRUPE_ppa011576mg [Prun... 66 4e-09 ref|XP_003519131.1| PREDICTED: thioredoxin H2-like [Glycine max] 66 6e-09 ref|XP_007157414.1| hypothetical protein PHAVU_002G068100g [Phas... 65 8e-09 ref|XP_003517914.1| PREDICTED: thioredoxin H2-like [Glycine max] 65 8e-09 ref|XP_006338484.1| PREDICTED: thioredoxin H2-like [Solanum tube... 65 1e-08 ref|XP_002324032.2| thioredoxin family protein [Populus trichoca... 65 1e-08 ref|XP_007032429.1| Thioredoxin 2 [Theobroma cacao] gi|508711458... 65 1e-08 gb|AAY42864.1| thioredoxin H [Nicotiana alata] 65 1e-08 ref|XP_007226116.1| hypothetical protein PRUPE_ppa013299mg [Prun... 64 2e-08 ref|XP_006357246.1| PREDICTED: thioredoxin H2-like [Solanum tube... 64 2e-08 ref|XP_004302362.1| PREDICTED: thioredoxin H2-like [Fragaria ves... 64 2e-08 >ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus communis] gi|223543469|gb|EEF45000.1| Thioredoxin H-type, putative [Ricinus communis] Length = 133 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 269 GVTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 GV +EFGVQAMPTF+L+KKGK+VD+V G KKDEL KKIEKH Sbjct: 90 GVAQEFGVQAMPTFVLVKKGKEVDRVVGAKKDELLKKIEKH 130 >ref|XP_004302361.1| PREDICTED: thioredoxin H2-like [Fragaria vesca subsp. vesca] Length = 133 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V++EFGVQAMPTF+LLK GK+VD+V G KKDEL+KK+EKH Sbjct: 93 VSQEFGVQAMPTFVLLKNGKEVDRVVGAKKDELEKKVEKH 132 >gb|ABG81098.1| thioredoxin H [Pelargonium x hortorum] Length = 53 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V REF VQAMPTF+L+KKGK+VD+V G KKDEL+KKI+KH Sbjct: 10 VAREFAVQAMPTFVLVKKGKEVDRVVGAKKDELEKKIQKH 49 >ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS88427.1| thioredoxin [Glycine max] Length = 135 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EF V+AMPTF+L KKGK+VDKV G KKDEL+KKIEKH Sbjct: 92 VAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKH 131 >gb|ACU15762.1| unknown [Glycine max] Length = 157 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EF V+AMPTF+L KKGK+VDKV G KKDEL+KKIEKH Sbjct: 114 VAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKH 153 >ref|XP_003552507.1| PREDICTED: thioredoxin H2 [Glycine max] Length = 133 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EF VQAMPTF+L KKGK+VDKV G KKDEL+KKIEKH Sbjct: 92 VAQEFQVQAMPTFVLWKKGKEVDKVVGAKKDELEKKIEKH 131 >gb|EYU28689.1| hypothetical protein MIMGU_mgv1a023737mg [Mimulus guttatus] Length = 134 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EFGVQAMPTFIL+K GK+VDKV G K+++LQKKIEKH Sbjct: 93 VAQEFGVQAMPTFILMKGGKEVDKVVGAKREDLQKKIEKH 132 >gb|EXB30121.1| Thioredoxin H2-2 [Morus notabilis] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EFGVQAMPTF+L KKGK+VD+V G KKDEL++K++KH Sbjct: 118 VAQEFGVQAMPTFVLTKKGKEVDRVVGAKKDELERKVQKH 157 >ref|XP_007139606.1| hypothetical protein PHAVU_008G044000g [Phaseolus vulgaris] gi|561012739|gb|ESW11600.1| hypothetical protein PHAVU_008G044000g [Phaseolus vulgaris] Length = 131 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V EF VQAMPTF+LLKKGK +DKV G KKDEL+KKIEKH Sbjct: 90 VAGEFQVQAMPTFVLLKKGKVIDKVVGAKKDELEKKIEKH 129 >ref|XP_007215973.1| hypothetical protein PRUPE_ppa011576mg [Prunus persica] gi|462412123|gb|EMJ17172.1| hypothetical protein PRUPE_ppa011576mg [Prunus persica] Length = 205 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EFGVQAMPTF+LLKKGK+VD+V G +KDEL+KKI+K+ Sbjct: 163 VAQEFGVQAMPTFVLLKKGKEVDRVIGARKDELEKKIQKY 202 >ref|XP_003519131.1| PREDICTED: thioredoxin H2-like [Glycine max] Length = 128 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 269 GVTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKHI 144 GV++EF V AMPTFIL+KKGK VDKV G KK+ELQK IEKH+ Sbjct: 86 GVSQEFQVHAMPTFILIKKGKVVDKVVGAKKEELQKLIEKHL 127 >ref|XP_007157414.1| hypothetical protein PHAVU_002G068100g [Phaseolus vulgaris] gi|561030829|gb|ESW29408.1| hypothetical protein PHAVU_002G068100g [Phaseolus vulgaris] Length = 127 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 269 GVTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKHI 144 GV+ EF VQAMPTFIL+KKGK VDKV G KK++LQK IEKH+ Sbjct: 85 GVSEEFQVQAMPTFILMKKGKVVDKVLGAKKEKLQKLIEKHL 126 >ref|XP_003517914.1| PREDICTED: thioredoxin H2-like [Glycine max] Length = 124 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKHI 144 V++EF VQAMPTFIL+KKGK VDKV G KK+ELQK IEKH+ Sbjct: 83 VSQEFKVQAMPTFILIKKGKVVDKVVGAKKEELQKLIEKHL 123 >ref|XP_006338484.1| PREDICTED: thioredoxin H2-like [Solanum tuberosum] Length = 142 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EFGVQAMPTF+LLK+GK+V++V G KKDEL+KKI KH Sbjct: 95 VAKEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKH 134 >ref|XP_002324032.2| thioredoxin family protein [Populus trichocarpa] gi|550320039|gb|EEF04165.2| thioredoxin family protein [Populus trichocarpa] Length = 140 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EFGVQAMPTF+L+KKG +VD+V G +K+ELQ+KIEKH Sbjct: 98 VAQEFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKH 137 >ref|XP_007032429.1| Thioredoxin 2 [Theobroma cacao] gi|508711458|gb|EOY03355.1| Thioredoxin 2 [Theobroma cacao] Length = 139 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EFGVQAMPTF+L+KKGK+VD+V G +K++L+KK+EKH Sbjct: 93 VAQEFGVQAMPTFVLVKKGKEVDRVVGAQKNDLEKKVEKH 132 >gb|AAY42864.1| thioredoxin H [Nicotiana alata] Length = 152 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +EFGVQAMPTF+LLK+GK+V++V G KKDEL+KKI KH Sbjct: 95 VAQEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKH 134 >ref|XP_007226116.1| hypothetical protein PRUPE_ppa013299mg [Prunus persica] gi|462423052|gb|EMJ27315.1| hypothetical protein PRUPE_ppa013299mg [Prunus persica] Length = 130 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V REFGVQAMP+F+ +KKG VDKV G +K+ELQKKIEKH Sbjct: 89 VAREFGVQAMPSFVFVKKGDVVDKVVGARKEELQKKIEKH 128 >ref|XP_006357246.1| PREDICTED: thioredoxin H2-like [Solanum tuberosum] Length = 135 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEKH 147 V +E+GVQAMPTFIL+KKGK VDK+ G KD LQKKI+KH Sbjct: 91 VAQEYGVQAMPTFILIKKGKVVDKIVGADKDGLQKKIQKH 130 >ref|XP_004302362.1| PREDICTED: thioredoxin H2-like [Fragaria vesca subsp. vesca] Length = 134 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -3 Query: 266 VTREFGVQAMPTFILLKKGKQVDKVTGTKKDELQKKIEK 150 V+++F VQAMPTF+LLKKGK+VD+V G KKDEL+KK+EK Sbjct: 91 VSQQFEVQAMPTFVLLKKGKEVDRVVGAKKDELEKKVEK 129