BLASTX nr result
ID: Paeonia22_contig00025813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00025813 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374806.1| hypothetical protein POPTR_0014s01140g [Popu... 66 4e-09 ref|XP_006374780.1| hypothetical protein POPTR_0014s00710g [Popu... 64 2e-08 ref|XP_006374750.1| hypothetical protein POPTR_0014s004701g, par... 63 4e-08 ref|XP_007033830.1| LRR and NB-ARC domains-containing disease re... 63 5e-08 ref|XP_002520787.1| leucine-rich repeat-containing protein 2, lr... 63 5e-08 ref|XP_004306155.1| PREDICTED: putative disease resistance prote... 62 8e-08 ref|XP_004298201.1| PREDICTED: putative adenylate cyclase regula... 62 8e-08 ref|XP_006374743.1| hypothetical protein POPTR_0014s00415g [Popu... 62 1e-07 ref|XP_006374742.1| Fom-2 family protein [Populus trichocarpa] g... 61 1e-07 ref|XP_004305152.1| PREDICTED: putative disease resistance prote... 61 1e-07 ref|XP_004296845.1| PREDICTED: probable disease resistance prote... 61 1e-07 ref|XP_006389377.1| hypothetical protein POPTR_0027s00490g [Popu... 61 2e-07 ref|XP_004306232.1| PREDICTED: putative disease resistance prote... 61 2e-07 ref|XP_004306126.1| PREDICTED: putative disease resistance prote... 61 2e-07 ref|XP_006374746.1| hypothetical protein POPTR_0014s00440g [Popu... 60 2e-07 ref|XP_007220044.1| hypothetical protein PRUPE_ppa026844mg [Prun... 60 3e-07 ref|XP_006384809.1| hypothetical protein POPTR_0004s21280g [Popu... 60 4e-07 ref|XP_006384808.1| hypothetical protein POPTR_0004s21280g [Popu... 60 4e-07 ref|XP_006374785.1| hypothetical protein POPTR_0014s00760g [Popu... 60 4e-07 ref|XP_006374759.1| hypothetical protein POPTR_0014s00536g [Popu... 60 4e-07 >ref|XP_006374806.1| hypothetical protein POPTR_0014s01140g [Populus trichocarpa] gi|550323082|gb|ERP52603.1| hypothetical protein POPTR_0014s01140g [Populus trichocarpa] Length = 1336 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 SSL+ L I C+NLK+LP+ A++RL+ L+ L + LCP LS NC E +GSEW K+ H+ Sbjct: 1273 SSLQSLRIYNCKNLKYLPSSTAIQRLSKLKQLRIYLCPHLSENCREENGSEWPKISHI 1330 >ref|XP_006374780.1| hypothetical protein POPTR_0014s00710g [Populus trichocarpa] gi|550323039|gb|ERP52577.1| hypothetical protein POPTR_0014s00710g [Populus trichocarpa] Length = 961 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/63 (46%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKL-CP-LSSNCAEPSGSEWFKVEHLL 305 SSL+ L+I C+NLK++P+ A++RL+NL+ L + CP LS NC E +GSEW K+ H+ Sbjct: 897 SSLQSLKIMSCKNLKYMPSSTAIQRLSNLKELVISWGCPHLSKNCREENGSEWPKISHIP 956 Query: 304 EVF 296 +++ Sbjct: 957 KIY 959 >ref|XP_006374750.1| hypothetical protein POPTR_0014s004701g, partial [Populus trichocarpa] gi|550323009|gb|ERP52547.1| hypothetical protein POPTR_0014s004701g, partial [Populus trichocarpa] Length = 978 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/62 (45%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 SSL+ L I +C+NLK++P+ A++RL+ L+ L + CP LS NC E +GSEW K+ H+ + Sbjct: 915 SSLQSLWIDDCKNLKYMPSSTAIQRLSKLKLLYIWYCPHLSENCREENGSEWPKISHIPK 974 Query: 301 VF 296 ++ Sbjct: 975 IY 976 >ref|XP_007033830.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508712859|gb|EOY04756.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1194 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 SSL+ L+I C NL +P+ EAM++L+ LQ L + CP L NCA+ SGSEW K+ HL Sbjct: 1125 SSLQRLQIWNCNNLTHMPSLEAMQQLSELQRLEINKCPQLKENCAKESGSEWPKISHL 1182 >ref|XP_002520787.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus communis] gi|223539918|gb|EEF41496.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus communis] Length = 1164 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/61 (49%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 SSLE L I C L++LPT M+RL+ L L + CP LS NC + SGSEW K+ H+ E Sbjct: 1073 SSLEHLNITNCWFLEYLPTATTMQRLSRLSKLEISACPILSKNCTKGSGSEWSKISHIPE 1132 Query: 301 V 299 + Sbjct: 1133 I 1133 >ref|XP_004306155.1| PREDICTED: putative disease resistance protein RGA3-like [Fragaria vesca subsp. vesca] Length = 1167 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/61 (50%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 +SL EL I++C LK+LP+ EAM+RLT LQ L V CP L C E SG EW K+ H+ Sbjct: 1105 ASLVELRIQDCEILKYLPSLEAMQRLTKLQRLEVIDCPLLEERCTEDSGEEWPKISHIQN 1164 Query: 301 V 299 + Sbjct: 1165 I 1165 >ref|XP_004298201.1| PREDICTED: putative adenylate cyclase regulatory protein-like [Fragaria vesca subsp. vesca] Length = 425 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 +SL +L I C NLK+LP+ EAM+RLT L L V CP L C + SG EW K+ H+L Sbjct: 362 ASLVQLSIEWCENLKYLPSLEAMQRLTKLDLLVVFRCPLLKQRCTKDSGEEWPKISHILH 421 Query: 301 V 299 V Sbjct: 422 V 422 >ref|XP_006374743.1| hypothetical protein POPTR_0014s00415g [Populus trichocarpa] gi|550323002|gb|ERP52540.1| hypothetical protein POPTR_0014s00415g [Populus trichocarpa] Length = 960 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/63 (47%), Positives = 45/63 (71%), Gaps = 2/63 (3%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVK-LCP-LSSNCAEPSGSEWFKVEHLL 305 SSL LEI C+NLK+LP+ A++RL+ L++L + CP LS NC E +GSEW K+ H+ Sbjct: 896 SSLRSLEIVGCKNLKYLPSSTAIKRLSKLKTLRISGGCPHLSENCREGNGSEWPKISHIP 955 Query: 304 EVF 296 +++ Sbjct: 956 QIY 958 >ref|XP_006374742.1| Fom-2 family protein [Populus trichocarpa] gi|550323001|gb|ERP52539.1| Fom-2 family protein [Populus trichocarpa] Length = 1188 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/64 (43%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 SSL+ L I C+NLK++P+ +++RL+ L++L + CP LS NC + +GSEW K+ HL Sbjct: 1119 SSLQYLAIIGCKNLKYMPSSTSIQRLSKLKTLDIYECPHLSENCRKENGSEWPKISHLPT 1178 Query: 301 VFTD 290 +F + Sbjct: 1179 IFIE 1182 >ref|XP_004305152.1| PREDICTED: putative disease resistance protein RGA1-like [Fragaria vesca subsp. vesca] Length = 1314 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/58 (50%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 +SL L+I C NL +LP+ +AM RLT L L + LCP LS C E SG EW K+ H+ Sbjct: 1251 ASLRSLDISNCENLMYLPSVQAMHRLTKLDRLHIWLCPLLSERCTEESGPEWPKISHI 1308 >ref|XP_004296845.1| PREDICTED: probable disease resistance protein At5g66900-like [Fragaria vesca subsp. vesca] Length = 187 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 +SLE+L + C +LK+LP+ EAM+RLT L+ + + CP L C E +G EW K+ HL Sbjct: 118 ASLEDLSVWGCESLKYLPSVEAMQRLTKLKEIKISFCPLLEERCTEETGPEWPKIRHL 175 >ref|XP_006389377.1| hypothetical protein POPTR_0027s00490g [Populus trichocarpa] gi|550312148|gb|ERP48291.1| hypothetical protein POPTR_0027s00490g [Populus trichocarpa] Length = 1216 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 SSL L I +C+NLK++P+ A++RL+ L+ L + CP LS NC + +GSEW K+ H+ Sbjct: 1143 SSLRSLWIWDCKNLKYMPSSTAIQRLSKLKELGISECPLLSENCRKENGSEWPKISHIPS 1202 Query: 301 VFTD 290 + + Sbjct: 1203 IIVE 1206 >ref|XP_004306232.1| PREDICTED: putative disease resistance protein RGA3-like [Fragaria vesca subsp. vesca] Length = 1279 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 +SLE L R C+NL FLP+ +AMR LT L++L++ CP L+ C + SG EW K+ H+ Sbjct: 1197 ASLEFLSFRNCKNLMFLPSVQAMRCLTKLETLSIHNCPLLTERCTKESGPEWPKISHI 1254 >ref|XP_004306126.1| PREDICTED: putative disease resistance protein RGA3-like [Fragaria vesca subsp. vesca] Length = 1053 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/58 (51%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 +SL +L I C NLK+LP+ EAM+RLT LQ L V CP L C + SG EW K+ H+ Sbjct: 989 ASLMDLRISNCENLKYLPSLEAMQRLTKLQCLEVIGCPLLEERCTKDSGEEWPKISHI 1046 >ref|XP_006374746.1| hypothetical protein POPTR_0014s00440g [Populus trichocarpa] gi|550323005|gb|ERP52543.1| hypothetical protein POPTR_0014s00440g [Populus trichocarpa] Length = 727 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/64 (42%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLC-PLSSNCAEPSGSEWFKVEHLLE 302 SSL+ L I C+NLK++P+ A++RL+ L+ L ++ C LS NC + +GSEW K+ H+ E Sbjct: 634 SSLQLLWIGNCKNLKYMPSSTAIQRLSKLKELRIRECRHLSKNCRKKNGSEWPKISHIPE 693 Query: 301 VFTD 290 ++ + Sbjct: 694 IYIE 697 >ref|XP_007220044.1| hypothetical protein PRUPE_ppa026844mg [Prunus persica] gi|462416506|gb|EMJ21243.1| hypothetical protein PRUPE_ppa026844mg [Prunus persica] Length = 1290 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 +SL L I++C+NL +LPT E ++RLT L+ L + CP L+ CA+ SG EW K+ H+ + Sbjct: 1220 TSLITLRIKDCKNLMYLPTVEVIQRLTKLRELDIDGCPCLAERCAKESGPEWHKIWHIPD 1279 Query: 301 V 299 + Sbjct: 1280 I 1280 >ref|XP_006384809.1| hypothetical protein POPTR_0004s21280g [Populus trichocarpa] gi|550341577|gb|ERP62606.1| hypothetical protein POPTR_0004s21280g [Populus trichocarpa] Length = 1159 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 SSL+EL I EC+NLK+LP+ AM+RL+ L L ++ CP L NC + SGSE + H+ Sbjct: 1087 SSLQELTISECQNLKYLPSSTAMQRLSKLTLLNIRSCPHLDRNCLKGSGSERSTISHI 1144 >ref|XP_006384808.1| hypothetical protein POPTR_0004s21280g [Populus trichocarpa] gi|550341576|gb|ERP62605.1| hypothetical protein POPTR_0004s21280g [Populus trichocarpa] Length = 1182 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHL 308 SSL+EL I EC+NLK+LP+ AM+RL+ L L ++ CP L NC + SGSE + H+ Sbjct: 1087 SSLQELTISECQNLKYLPSSTAMQRLSKLTLLNIRSCPHLDRNCLKGSGSERSTISHI 1144 >ref|XP_006374785.1| hypothetical protein POPTR_0014s00760g [Populus trichocarpa] gi|550323044|gb|ERP52582.1| hypothetical protein POPTR_0014s00760g [Populus trichocarpa] Length = 1176 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/62 (41%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLCP-LSSNCAEPSGSEWFKVEHLLE 302 SSL+ L I C+N ++LP+ A++RL+ L++L ++ CP L NC + +GSEW K+ H+ + Sbjct: 1114 SSLQSLTIVGCKNFEYLPSSTAIQRLSKLKTLYIRECPHLKENCRKENGSEWPKISHIPQ 1173 Query: 301 VF 296 V+ Sbjct: 1174 VY 1175 >ref|XP_006374759.1| hypothetical protein POPTR_0014s00536g [Populus trichocarpa] gi|550323018|gb|ERP52556.1| hypothetical protein POPTR_0014s00536g [Populus trichocarpa] Length = 215 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = -3 Query: 478 SSLEELEIRECRNLKFLPTEEAMRRLTNLQSLTVKLC-PLSSNCAEPSGSEWFKVEHLLE 302 SSL+ L I C+NLK+LP+ A++RL+ L+ L + C L NC + +GSEW K+ H+ E Sbjct: 133 SSLQSLWISHCKNLKYLPSSTAIQRLSKLKELEISGCRHLKENCRKENGSEWPKISHIPE 192 Query: 301 VFTD 290 + D Sbjct: 193 ISID 196