BLASTX nr result
ID: Paeonia22_contig00025808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00025808 (660 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006436748.1| hypothetical protein CICLE_v10031966mg [Citr... 63 9e-08 gb|EXB99766.1| NAC domain-containing protein 74 [Morus notabilis] 61 3e-07 ref|XP_007209299.1| hypothetical protein PRUPE_ppa007828mg [Prun... 61 3e-07 ref|XP_002280894.2| PREDICTED: NAC domain-containing protein 68-... 61 3e-07 emb|CAN78113.1| hypothetical protein VITISV_004432 [Vitis vinifera] 61 3e-07 gb|AAM34774.1|AF509874_1 nam-like protein 11 [Petunia x hybrida] 61 3e-07 ref|XP_006352840.1| PREDICTED: NAC domain-containing protein 72-... 61 4e-07 ref|XP_004511780.1| PREDICTED: NAC domain-containing protein 89-... 61 4e-07 ref|XP_004511779.1| PREDICTED: NAC domain-containing protein 89-... 61 4e-07 ref|XP_004245880.1| PREDICTED: NAC domain-containing protein 43-... 61 4e-07 ref|XP_003611470.1| NAC domain protein [Medicago truncatula] gi|... 61 4e-07 ref|XP_007155764.1| hypothetical protein PHAVU_003G229600g [Phas... 60 6e-07 ref|XP_003549977.1| PREDICTED: NAC domain-containing protein 78-... 60 6e-07 ref|XP_003524716.1| PREDICTED: NAC domain-containing protein 78-... 60 6e-07 ref|XP_006398354.1| hypothetical protein EUTSA_v10001200mg, part... 60 8e-07 gb|AGL39701.1| NAC transcription factor 045 [Jatropha curcas] 60 8e-07 gb|AHJ79196.1| NAC domain protein NAC55 [Gossypium hirsutum] 59 1e-06 ref|XP_007039543.1| NAC domain protein, IPR003441 [Theobroma cac... 59 1e-06 ref|XP_004300256.1| PREDICTED: protein CUP-SHAPED COTYLEDON 1-li... 59 1e-06 gb|AHJ79176.1| NAC domain protein NAC35 [Gossypium hirsutum] 59 1e-06 >ref|XP_006436748.1| hypothetical protein CICLE_v10031966mg [Citrus clementina] gi|568864078|ref|XP_006485436.1| PREDICTED: NAC domain-containing protein 78-like [Citrus sinensis] gi|557538944|gb|ESR49988.1| hypothetical protein CICLE_v10031966mg [Citrus clementina] Length = 350 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+ELV YYLKRKVDG Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKVDG 30 >gb|EXB99766.1| NAC domain-containing protein 74 [Morus notabilis] Length = 346 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+ELV YYLKRKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKVEG 30 >ref|XP_007209299.1| hypothetical protein PRUPE_ppa007828mg [Prunus persica] gi|462405034|gb|EMJ10498.1| hypothetical protein PRUPE_ppa007828mg [Prunus persica] Length = 354 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+ELV YYLKRKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKVEG 30 >ref|XP_002280894.2| PREDICTED: NAC domain-containing protein 68-like [Vitis vinifera] gi|297742117|emb|CBI33904.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+ELV YYLKRKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKVEG 30 >emb|CAN78113.1| hypothetical protein VITISV_004432 [Vitis vinifera] Length = 365 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+ELV YYLKRKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKVEG 30 >gb|AAM34774.1|AF509874_1 nam-like protein 11 [Petunia x hybrida] Length = 337 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+ELV YYLKRK DG Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKTDG 30 >ref|XP_006352840.1| PREDICTED: NAC domain-containing protein 72-like [Solanum tuberosum] Length = 333 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 M GTSLPPGFRFHPTD+ELV YYLKRK DG Sbjct: 1 MAGTSLPPGFRFHPTDEELVGYYLKRKTDG 30 >ref|XP_004511780.1| PREDICTED: NAC domain-containing protein 89-like isoform X2 [Cicer arietinum] Length = 342 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+EL+ YYLKRKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELIGYYLKRKVEG 30 >ref|XP_004511779.1| PREDICTED: NAC domain-containing protein 89-like isoform X1 [Cicer arietinum] Length = 336 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+EL+ YYLKRKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELIGYYLKRKVEG 30 >ref|XP_004245880.1| PREDICTED: NAC domain-containing protein 43-like [Solanum lycopersicum] Length = 340 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 M GTSLPPGFRFHPTD+ELV YYLKRK DG Sbjct: 1 MAGTSLPPGFRFHPTDEELVGYYLKRKTDG 30 >ref|XP_003611470.1| NAC domain protein [Medicago truncatula] gi|355512805|gb|AES94428.1| NAC domain protein [Medicago truncatula] Length = 342 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+EL+ YYLKRKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELIGYYLKRKVEG 30 >ref|XP_007155764.1| hypothetical protein PHAVU_003G229600g [Phaseolus vulgaris] gi|561029118|gb|ESW27758.1| hypothetical protein PHAVU_003G229600g [Phaseolus vulgaris] Length = 342 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG +LPPGFRFHPTD+ELV YYLKRKV+G Sbjct: 1 MGGATLPPGFRFHPTDEELVGYYLKRKVEG 30 >ref|XP_003549977.1| PREDICTED: NAC domain-containing protein 78-like [Glycine max] Length = 342 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG +LPPGFRFHPTD+ELV YYLKRKV+G Sbjct: 1 MGGATLPPGFRFHPTDEELVGYYLKRKVEG 30 >ref|XP_003524716.1| PREDICTED: NAC domain-containing protein 78-like [Glycine max] Length = 345 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG +LPPGFRFHPTD+ELV YYLKRKV+G Sbjct: 1 MGGATLPPGFRFHPTDEELVGYYLKRKVEG 30 >ref|XP_006398354.1| hypothetical protein EUTSA_v10001200mg, partial [Eutrema salsugineum] gi|557099443|gb|ESQ39807.1| hypothetical protein EUTSA_v10001200mg, partial [Eutrema salsugineum] Length = 286 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MG + LPPGFRFHPTD+EL+DYYLKRKV+G Sbjct: 1 MGSSCLPPGFRFHPTDEELIDYYLKRKVEG 30 >gb|AGL39701.1| NAC transcription factor 045 [Jatropha curcas] Length = 304 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTDDELV YYL RKV G Sbjct: 1 MGGASLPPGFRFHPTDDELVGYYLHRKVQG 30 >gb|AHJ79196.1| NAC domain protein NAC55 [Gossypium hirsutum] Length = 326 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+EL+ YYLKRK +G Sbjct: 1 MGGASLPPGFRFHPTDEELIGYYLKRKTEG 30 >ref|XP_007039543.1| NAC domain protein, IPR003441 [Theobroma cacao] gi|508776788|gb|EOY24044.1| NAC domain protein, IPR003441 [Theobroma cacao] Length = 338 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+EL+ YYLKRK +G Sbjct: 1 MGGASLPPGFRFHPTDEELIGYYLKRKTEG 30 >ref|XP_004300256.1| PREDICTED: protein CUP-SHAPED COTYLEDON 1-like [Fragaria vesca subsp. vesca] Length = 369 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+ELV YYL RKV+G Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLSRKVEG 30 >gb|AHJ79176.1| NAC domain protein NAC35 [Gossypium hirsutum] Length = 327 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 90 MGGTSLPPGFRFHPTDDELVDYYLKRKVDG 1 MGG SLPPGFRFHPTD+EL+ YYLKRK +G Sbjct: 1 MGGPSLPPGFRFHPTDEELIGYYLKRKTEG 30