BLASTX nr result
ID: Paeonia22_contig00025795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00025795 (199 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007215592.1| hypothetical protein PRUPE_ppa007675mg [Prun... 90 3e-16 gb|EXB98271.1| hypothetical protein L484_014256 [Morus notabilis] 89 5e-16 ref|XP_006469451.1| PREDICTED: fasciclin-like arabinogalactan pr... 89 5e-16 ref|XP_006447810.1| hypothetical protein CICLE_v10015469mg [Citr... 89 5e-16 ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma ... 89 6e-16 ref|XP_002534396.1| conserved hypothetical protein [Ricinus comm... 89 6e-16 gb|ACL36352.1| fascilin-like arabinogalactan protein [Gossypium ... 88 1e-15 ref|XP_006415013.1| hypothetical protein EUTSA_v10025352mg [Eutr... 87 3e-15 ref|XP_006286070.1| hypothetical protein CARUB_v10007603mg [Caps... 87 3e-15 gb|AAK20858.1|AF333971_1 fasciclin-like arabinogalactan-protein ... 87 3e-15 ref|XP_002863317.1| hypothetical protein ARALYDRAFT_497154 [Arab... 87 3e-15 gb|ABV27490.1| fasciclin-like arabinogalactan protein 19 [Gossyp... 87 3e-15 gb|AAM65777.1| putative pollen surface protein [Arabidopsis thal... 87 3e-15 ref|NP_193009.1| fasciclin-like arabinogalactan protein 2 [Arabi... 87 3e-15 ref|XP_004303568.1| PREDICTED: fasciclin-like arabinogalactan pr... 85 9e-15 ref|XP_004144548.1| PREDICTED: fasciclin-like arabinogalactan pr... 84 3e-14 gb|EYU42817.1| hypothetical protein MIMGU_mgv1a007557mg [Mimulus... 82 6e-14 ref|XP_002320524.2| hypothetical protein POPTR_0014s16610g [Popu... 82 6e-14 gb|AAM78212.1| putative pollen surface protein [Gossypium barbad... 80 2e-13 ref|XP_002267825.1| PREDICTED: fasciclin-like arabinogalactan pr... 80 3e-13 >ref|XP_007215592.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica] gi|462411742|gb|EMJ16791.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica] Length = 359 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/65 (66%), Positives = 49/65 (75%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS LTS EAEAPTA P QLNLT +L K GC AF DLL++S A TFE ++GGLT+FC Sbjct: 170 QISQVLTSAEAEAPTAGPSQLNLTAILSKQGCKAFADLLISSGADTTFETNIDGGLTVFC 229 Query: 17 PTDGV 3 PTD V Sbjct: 230 PTDAV 234 >gb|EXB98271.1| hypothetical protein L484_014256 [Morus notabilis] Length = 369 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/65 (66%), Positives = 49/65 (75%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS LTS EAEAPTA P +LNLTT+L K GC AF DLL A+ A TF+ +E GLT+FC Sbjct: 155 QISQILTSAEAEAPTAAPSELNLTTILSKQGCKAFADLLKATGADTTFQTNIEAGLTVFC 214 Query: 17 PTDGV 3 PTDGV Sbjct: 215 PTDGV 219 >ref|XP_006469451.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Citrus sinensis] Length = 403 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/65 (64%), Positives = 48/65 (73%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QISH L S EAEAPT P LNLT ++ K GC AF DLL+A+ A TFEE L+GGLT+FC Sbjct: 171 QISHVLNSDEAEAPTPGPSGLNLTAIMAKQGCKAFADLLIATGAHTTFEENLDGGLTVFC 230 Query: 17 PTDGV 3 PTD V Sbjct: 231 PTDAV 235 >ref|XP_006447810.1| hypothetical protein CICLE_v10015469mg [Citrus clementina] gi|557550421|gb|ESR61050.1| hypothetical protein CICLE_v10015469mg [Citrus clementina] Length = 403 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/65 (64%), Positives = 48/65 (73%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QISH L S EAEAPT P LNLT ++ K GC AF DLL+A+ A TFEE L+GGLT+FC Sbjct: 171 QISHVLNSDEAEAPTPGPSGLNLTAIMAKQGCKAFADLLIATGAHTTFEENLDGGLTVFC 230 Query: 17 PTDGV 3 PTD V Sbjct: 231 PTDAV 235 >ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao] gi|508701629|gb|EOX93525.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao] Length = 399 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/65 (66%), Positives = 48/65 (73%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS L S EAEAPTAEP QLNLT ++ K GC AF DLL AS A TF E ++GGLT+FC Sbjct: 171 QISQVLNSAEAEAPTAEPSQLNLTEIMSKQGCKAFADLLKASGADATFNENIDGGLTVFC 230 Query: 17 PTDGV 3 PTD V Sbjct: 231 PTDPV 235 >ref|XP_002534396.1| conserved hypothetical protein [Ricinus communis] gi|223525379|gb|EEF27989.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/65 (67%), Positives = 51/65 (78%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS AL S EAEAPTA P LNLT ++ K GC AFTDLL AS A+ TFEET++GGLT+FC Sbjct: 99 QISEALNSAEAEAPTAAP-SLNLTEIMSKQGCKAFTDLLKASGAQSTFEETVDGGLTVFC 157 Query: 17 PTDGV 3 PTD + Sbjct: 158 PTDPI 162 >gb|ACL36352.1| fascilin-like arabinogalactan protein [Gossypium hirsutum] Length = 397 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS L S EAEAPTAEP +LNLT ++ K GC AF DLL++S A TF E ++GGLT+FC Sbjct: 163 QISQVLNSAEAEAPTAEPSKLNLTEIMSKQGCKAFADLLISSGADATFNENIDGGLTVFC 222 Query: 17 PTDGV 3 PTD V Sbjct: 223 PTDPV 227 >ref|XP_006415013.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum] gi|557116183|gb|ESQ56466.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum] Length = 405 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -3 Query: 194 ISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFCP 15 IS LTSPEAEAPTA P L LTT+L K GC AF+D+L ++ A KTF++T++GGLT+FCP Sbjct: 170 ISQVLTSPEAEAPTASPSDLILTTILEKQGCKAFSDILKSTGADKTFQDTVDGGLTVFCP 229 Query: 14 TD 9 +D Sbjct: 230 SD 231 >ref|XP_006286070.1| hypothetical protein CARUB_v10007603mg [Capsella rubella] gi|482554775|gb|EOA18968.1| hypothetical protein CARUB_v10007603mg [Capsella rubella] Length = 402 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -3 Query: 194 ISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFCP 15 IS LTSPEAEAPTA P L LTT+L K GC AF+D+L ++ A KTF++T++GGLT+FCP Sbjct: 170 ISQVLTSPEAEAPTASPSDLILTTILEKQGCKAFSDILKSTGADKTFQDTVDGGLTVFCP 229 Query: 14 TD 9 +D Sbjct: 230 SD 231 >gb|AAK20858.1|AF333971_1 fasciclin-like arabinogalactan-protein 2 [Arabidopsis thaliana] Length = 403 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -3 Query: 194 ISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFCP 15 IS LTSPEAEAPTA P L LTT+L K GC AF+D+L ++ A KTF++T++GGLT+FCP Sbjct: 170 ISQVLTSPEAEAPTASPSDLILTTILEKQGCKAFSDILKSTGADKTFQDTVDGGLTVFCP 229 Query: 14 TD 9 +D Sbjct: 230 SD 231 >ref|XP_002863317.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. lyrata] gi|297309151|gb|EFH39576.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. lyrata] Length = 403 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -3 Query: 194 ISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFCP 15 IS LTSPEAEAPTA P L LTT+L K GC AF+D+L ++ A KTF++T++GGLT+FCP Sbjct: 170 ISQVLTSPEAEAPTASPSDLILTTILEKQGCKAFSDILKSTGADKTFQDTVDGGLTVFCP 229 Query: 14 TD 9 +D Sbjct: 230 SD 231 >gb|ABV27490.1| fasciclin-like arabinogalactan protein 19 [Gossypium hirsutum] Length = 398 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS L S EAEAPTAEP +LNLT ++ K GC +F DLL++S A TF E ++GGLT+FC Sbjct: 164 QISQVLNSAEAEAPTAEPSKLNLTEIMSKQGCKSFADLLISSGADATFNENIDGGLTVFC 223 Query: 17 PTDGV 3 PTD V Sbjct: 224 PTDPV 228 >gb|AAM65777.1| putative pollen surface protein [Arabidopsis thaliana] Length = 403 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -3 Query: 194 ISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFCP 15 IS LTSPEAEAPTA P L LTT+L K GC AF+D+L ++ A KTF++T++GGLT+FCP Sbjct: 170 ISQVLTSPEAEAPTASPSDLILTTILEKQGCKAFSDILKSTGADKTFQDTVDGGLTVFCP 229 Query: 14 TD 9 +D Sbjct: 230 SD 231 >ref|NP_193009.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana] gi|75207770|sp|Q9SU13.1|FLA2_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 2; Flags: Precursor gi|4586249|emb|CAB40990.1| putative pollen surface protein [Arabidopsis thaliana] gi|7267974|emb|CAB78315.1| putative pollen surface protein [Arabidopsis thaliana] gi|16974609|gb|AAL31207.1| AT4g12730/T20K18_80 [Arabidopsis thaliana] gi|22655474|gb|AAM98329.1| At4g12730/T20K18_80 [Arabidopsis thaliana] gi|110741221|dbj|BAF02161.1| fasciclin-like arabinogalactan protein FLA2 [Arabidopsis thaliana] gi|332657771|gb|AEE83171.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana] Length = 403 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -3 Query: 194 ISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFCP 15 IS LTSPEAEAPTA P L LTT+L K GC AF+D+L ++ A KTF++T++GGLT+FCP Sbjct: 170 ISQVLTSPEAEAPTASPSDLILTTILEKQGCKAFSDILKSTGADKTFQDTVDGGLTVFCP 229 Query: 14 TD 9 +D Sbjct: 230 SD 231 >ref|XP_004303568.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Fragaria vesca subsp. vesca] Length = 406 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/65 (60%), Positives = 50/65 (76%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS LTS EAEAPTA P +NLT++L K GC AF+DLL+++ A TF+ ++GGLT+FC Sbjct: 172 QISQVLTSAEAEAPTAGPSDVNLTSILAKQGCKAFSDLLISTGADTTFQNNVDGGLTVFC 231 Query: 17 PTDGV 3 PTD V Sbjct: 232 PTDAV 236 >ref|XP_004144548.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis sativus] gi|449521924|ref|XP_004167979.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis sativus] Length = 418 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/63 (58%), Positives = 50/63 (79%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS +TS +AEAPTA P+ LNLT VL K GC AF+DLL+A+ A +T++ ++GGLT+FC Sbjct: 170 QISKVITSADAEAPTAAPVSLNLTEVLPKQGCKAFSDLLIAAGAIETYQSNVDGGLTMFC 229 Query: 17 PTD 9 PT+ Sbjct: 230 PTE 232 >gb|EYU42817.1| hypothetical protein MIMGU_mgv1a007557mg [Mimulus guttatus] Length = 403 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/63 (58%), Positives = 48/63 (76%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QISH L+SPEAEAPTA P NLT ++ + GC AF+DL+ A A TF +++EGGLT+FC Sbjct: 169 QISHILSSPEAEAPTAGPGDTNLTVLMARQGCKAFSDLITADGAADTFAQSVEGGLTIFC 228 Query: 17 PTD 9 P+D Sbjct: 229 PSD 231 >ref|XP_002320524.2| hypothetical protein POPTR_0014s16610g [Populus trichocarpa] gi|550324345|gb|EEE98839.2| hypothetical protein POPTR_0014s16610g [Populus trichocarpa] Length = 397 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/65 (63%), Positives = 48/65 (73%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS L S EAEAPTA P LN+T +L GC AF+DLL+AS A TFEE ++GGLT+FC Sbjct: 168 QISQPLNSAEAEAPTAAPT-LNVTAILSNQGCKAFSDLLIASGAHTTFEENVDGGLTVFC 226 Query: 17 PTDGV 3 PTD V Sbjct: 227 PTDPV 231 >gb|AAM78212.1| putative pollen surface protein [Gossypium barbadense] Length = 213 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/60 (63%), Positives = 43/60 (71%) Frame = -3 Query: 185 ALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFCPTDG 6 AL S EAEAPTA P QLNLT ++ K GC AF DLL AS A F E ++ GLT+FCPTDG Sbjct: 1 ALNSAEAEAPTAAPSQLNLTEIMSKQGCKAFADLLTASGADDKFNENMDAGLTVFCPTDG 60 >ref|XP_002267825.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Vitis vinifera] Length = 405 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/65 (58%), Positives = 46/65 (70%) Frame = -3 Query: 197 QISHALTSPEAEAPTAEPIQLNLTTVLHKHGCNAFTDLLLASAARKTFEETLEGGLTLFC 18 QIS L S EAEAPT P + NLT ++ HGC F D L+AS A+KT+E+ LEGGLT+FC Sbjct: 171 QISKILPSEEAEAPTPGPSEQNLTALMSAHGCKVFADTLVASDAQKTYEDNLEGGLTVFC 230 Query: 17 PTDGV 3 P D V Sbjct: 231 PMDDV 235