BLASTX nr result
ID: Paeonia22_contig00025693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00025693 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284246.1| PREDICTED: GTP-binding protein At2g22870 [Vi... 79 7e-13 ref|XP_002324249.1| hypothetical protein POPTR_0018s00820g [Popu... 57 2e-06 ref|XP_004245257.1| PREDICTED: GTP-binding protein At2g22870-lik... 56 5e-06 ref|XP_006356644.1| PREDICTED: GTP-binding protein At2g22870-lik... 55 8e-06 >ref|XP_002284246.1| PREDICTED: GTP-binding protein At2g22870 [Vitis vinifera] gi|296081893|emb|CBI20898.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 79.0 bits (193), Expect = 7e-13 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 3/100 (3%) Frame = +2 Query: 89 MLVTHLPRLHSIFIPTVPSPFFYTRHLHLLYKPKLSITPKFTLSAVESTVPTSTFLHTHI 268 M+VTHLP+LH+ F + P P YT HL LL PK ++T T + +T P I Sbjct: 1 MVVTHLPKLHTHFFISTPPPSLYTHHLSLLRIPKSTLTTAATAATSSTTHPPP------I 54 Query: 269 ETPDNKGTPIEISLEKLFIPPETDISPGSVP---RVLKGS 379 TPD T I+I L+ LF+PPETDIS S P R+LKGS Sbjct: 55 STPD---THIQIPLQNLFVPPETDISATSTPLTARILKGS 91 >ref|XP_002324249.1| hypothetical protein POPTR_0018s00820g [Populus trichocarpa] gi|222865683|gb|EEF02814.1| hypothetical protein POPTR_0018s00820g [Populus trichocarpa] Length = 316 Score = 57.4 bits (137), Expect = 2e-06 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 9/106 (8%) Frame = +2 Query: 89 MLVTHLPRLH-SIFIPTVPSPFFYTRHLHLLYKPKLSITPKFTLSAVESTVPTST---FL 256 M ++ LP+LH SIF +PSP+ + +L L+ K KLS TLS ++STV T+ F Sbjct: 1 MALSRLPKLHFSIFTHPLPSPYTHI-NLPLITKLKLS-----TLSRLKSTVTTTEPIPFT 54 Query: 257 HTHIETPDNKGTPIEISLEKLFIPPETDI-----SPGSVPRVLKGS 379 H + T + SL+KLFIPP+T++ S G RVLKGS Sbjct: 55 EAHNLLALQEQTQTQFSLDKLFIPPDTEVSVNENSSGLSARVLKGS 100 >ref|XP_004245257.1| PREDICTED: GTP-binding protein At2g22870-like [Solanum lycopersicum] Length = 319 Score = 56.2 bits (134), Expect = 5e-06 Identities = 42/108 (38%), Positives = 56/108 (51%), Gaps = 11/108 (10%) Frame = +2 Query: 89 MLVTHLPRLHSIFIPTVPSPFFYTRHLHLLYKPKLSITPKFTLSAVESTVPTSTFLHT-- 262 M +THLP+LHS F +P LL K K + F+ +T +T L T Sbjct: 1 MFITHLPKLHSHFFIFYSTPRIIITSA-LLSKSKTTPVSHFS----SATAAANTLLQTPE 55 Query: 263 -----HIETPDNKGTP-IEISLEKLFIPPETDISPGSVP---RVLKGS 379 ++E D P +EIS+EKLF PP+TD+S GS P R+LKGS Sbjct: 56 LLQAKNLEIEDVLEKPHVEISVEKLFFPPDTDVSSGSRPLSSRILKGS 103 >ref|XP_006356644.1| PREDICTED: GTP-binding protein At2g22870-like [Solanum tuberosum] Length = 319 Score = 55.5 bits (132), Expect = 8e-06 Identities = 41/104 (39%), Positives = 57/104 (54%), Gaps = 7/104 (6%) Frame = +2 Query: 89 MLVTHLPRLHSIFIPTVPSPFFYTRHLHLLYKPKLSITPKFT--LSAVESTVPTSTFLHT 262 M ++HLP+LHS F +P LL K K + F+ +A + + T L T Sbjct: 1 MFISHLPKLHSHFSIFYSTPKIIITSA-LLSKSKTTPVSHFSSVTAAANTLLQTPELLQT 59 Query: 263 -HIETPDNKGTP-IEISLEKLFIPPETDISPGSVP---RVLKGS 379 ++E D P +EIS+EKLF PP+TD+S GS P R+LKGS Sbjct: 60 KNLEIEDVLEKPHVEISVEKLFFPPDTDVSSGSRPLSSRILKGS 103