BLASTX nr result
ID: Paeonia22_contig00025383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00025383 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206711.1| hypothetical protein PRUPE_ppa024131mg [Prun... 48 8e-06 >ref|XP_007206711.1| hypothetical protein PRUPE_ppa024131mg [Prunus persica] gi|462402353|gb|EMJ07910.1| hypothetical protein PRUPE_ppa024131mg [Prunus persica] Length = 1003 Score = 48.1 bits (113), Expect(2) = 8e-06 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +1 Query: 55 GCKETTYDGQKSIYTAWPLPFVSRDFVVKLADKN 156 G + YDG KSIYTA PLPFVS++FVVKL +++ Sbjct: 205 GRRTPAYDGMKSIYTAGPLPFVSKEFVVKLGERD 238 Score = 26.9 bits (58), Expect(2) = 8e-06 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 5 SR*IIW*TIHMYRDSHLGAKRP 70 +R +I +H+Y+DSHLG + P Sbjct: 188 NRDVIKQLVHLYKDSHLGRRTP 209