BLASTX nr result
ID: Paeonia22_contig00025253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00025253 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001241346.1| uncharacterized protein LOC100791242 [Glycin... 75 7e-12 ref|XP_006348470.1| PREDICTED: uncharacterized protein LOC102578... 74 2e-11 ref|XP_006348469.1| PREDICTED: uncharacterized protein LOC102578... 74 2e-11 ref|XP_004228676.1| PREDICTED: uncharacterized protein LOC101262... 74 2e-11 gb|EYU18120.1| hypothetical protein MIMGU_mgv1a012215mg [Mimulus... 73 5e-11 ref|XP_004303420.1| PREDICTED: uncharacterized protein LOC101308... 73 5e-11 ref|XP_002266364.1| PREDICTED: uncharacterized protein LOC100260... 73 5e-11 ref|XP_002309251.2| hypothetical protein POPTR_0006s21980g [Popu... 72 6e-11 ref|XP_007027973.1| NC domain-containing protein-related isoform... 72 6e-11 ref|XP_006399108.1| hypothetical protein EUTSA_v10014443mg [Eutr... 71 1e-10 ref|XP_004497660.1| PREDICTED: uncharacterized protein LOC101505... 71 1e-10 ref|NP_568167.1| lecithin retinol acyltransferase domain protein... 71 1e-10 ref|XP_006288489.1| hypothetical protein CARUB_v10001754mg [Caps... 71 2e-10 ref|XP_002533900.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_007145790.1| hypothetical protein PHAVU_007G268000g [Phas... 70 3e-10 ref|XP_003519117.1| PREDICTED: uncharacterized protein LOC100811... 70 3e-10 gb|ACU23792.1| unknown [Glycine max] 70 3e-10 gb|EPS62196.1| hypothetical protein M569_12596, partial [Genlise... 70 4e-10 ref|XP_007202460.1| hypothetical protein PRUPE_ppa010106mg [Prun... 70 4e-10 ref|XP_002873253.1| NC domain-containing protein [Arabidopsis ly... 69 5e-10 >ref|NP_001241346.1| uncharacterized protein LOC100791242 [Glycine max] gi|255641622|gb|ACU21083.1| unknown [Glycine max] Length = 259 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GD+KVIH TRHGQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDDKVIHFTRHGQ 48 >ref|XP_006348470.1| PREDICTED: uncharacterized protein LOC102578879 isoform X2 [Solanum tuberosum] Length = 247 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GDNKVIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDNKVIHFTRRGQ 48 >ref|XP_006348469.1| PREDICTED: uncharacterized protein LOC102578879 isoform X1 [Solanum tuberosum] Length = 258 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GDNKVIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDNKVIHFTRRGQ 48 >ref|XP_004228676.1| PREDICTED: uncharacterized protein LOC101262646 [Solanum lycopersicum] Length = 258 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GDNKVIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDNKVIHFTRRGQ 48 >gb|EYU18120.1| hypothetical protein MIMGU_mgv1a012215mg [Mimulus guttatus] Length = 258 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDH+YSWRTAYIY+HHGIY GDNKV+H TR GQ Sbjct: 15 PGDHVYSWRTAYIYSHHGIYIGDNKVVHFTRRGQ 48 >ref|XP_004303420.1| PREDICTED: uncharacterized protein LOC101308594 [Fragaria vesca subsp. vesca] Length = 299 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GD+KVIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYIGDDKVIHFTRRGQ 48 >ref|XP_002266364.1| PREDICTED: uncharacterized protein LOC100260806 [Vitis vinifera] gi|296083153|emb|CBI22789.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIY+HHGIY G+N+VIH TRHGQ Sbjct: 15 PGDHIYSWRTAYIYSHHGIYVGNNEVIHFTRHGQ 48 >ref|XP_002309251.2| hypothetical protein POPTR_0006s21980g [Populus trichocarpa] gi|550336830|gb|EEE92774.2| hypothetical protein POPTR_0006s21980g [Populus trichocarpa] Length = 306 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GD+KV+H TR GQ Sbjct: 61 PGDHIYSWRTAYIYAHHGIYIGDDKVVHFTRRGQ 94 >ref|XP_007027973.1| NC domain-containing protein-related isoform 1 [Theobroma cacao] gi|508716578|gb|EOY08475.1| NC domain-containing protein-related isoform 1 [Theobroma cacao] Length = 338 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY G+++VIH TRHGQ Sbjct: 87 PGDHIYSWRTAYIYAHHGIYVGNDRVIHFTRHGQ 120 >ref|XP_006399108.1| hypothetical protein EUTSA_v10014443mg [Eutrema salsugineum] gi|557100198|gb|ESQ40561.1| hypothetical protein EUTSA_v10014443mg [Eutrema salsugineum] Length = 259 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GD++VIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDDRVIHFTRRGQ 48 >ref|XP_004497660.1| PREDICTED: uncharacterized protein LOC101505670 isoform X1 [Cicer arietinum] gi|502122267|ref|XP_004497661.1| PREDICTED: uncharacterized protein LOC101505670 isoform X2 [Cicer arietinum] Length = 264 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 347 GDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 GDH+YSWRTAYIYAHHGIY GDNKV+H TR GQ Sbjct: 16 GDHVYSWRTAYIYAHHGIYIGDNKVVHFTRRGQ 48 >ref|NP_568167.1| lecithin retinol acyltransferase domain protein [Arabidopsis thaliana] gi|14190475|gb|AAK55718.1|AF380637_1 AT5g06370/MHF15_11 [Arabidopsis thaliana] gi|15809734|gb|AAL06795.1| AT5g06370/MHF15_11 [Arabidopsis thaliana] gi|110741026|dbj|BAE98607.1| hypothetical protein [Arabidopsis thaliana] gi|332003624|gb|AED91007.1| lecithin retinol acyltransferase domain protein [Arabidopsis thaliana] Length = 259 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GD++VIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDDRVIHFTRRGQ 48 >ref|XP_006288489.1| hypothetical protein CARUB_v10001754mg [Capsella rubella] gi|482557195|gb|EOA21387.1| hypothetical protein CARUB_v10001754mg [Capsella rubella] Length = 259 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHG+Y GD++VIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGVYVGDDRVIHFTRRGQ 48 >ref|XP_002533900.1| conserved hypothetical protein [Ricinus communis] gi|223526142|gb|EEF28482.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWR AY+YAHHGIY GD+KVIH TR GQ Sbjct: 15 PGDHIYSWRAAYVYAHHGIYIGDDKVIHFTRRGQ 48 >ref|XP_007145790.1| hypothetical protein PHAVU_007G268000g [Phaseolus vulgaris] gi|561018980|gb|ESW17784.1| hypothetical protein PHAVU_007G268000g [Phaseolus vulgaris] Length = 263 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GD+ VIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDDTVIHFTRRGQ 48 >ref|XP_003519117.1| PREDICTED: uncharacterized protein LOC100811771 isoform X1 [Glycine max] Length = 259 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY D+KVIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVSDDKVIHFTRRGQ 48 >gb|ACU23792.1| unknown [Glycine max] Length = 259 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY D+KVIH TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVSDDKVIHFTRRGQ 48 >gb|EPS62196.1| hypothetical protein M569_12596, partial [Genlisea aurea] Length = 246 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWR+AYIYAHHGIY GD +VIH TR GQ Sbjct: 10 PGDHIYSWRSAYIYAHHGIYMGDERVIHFTRRGQ 43 >ref|XP_007202460.1| hypothetical protein PRUPE_ppa010106mg [Prunus persica] gi|462397991|gb|EMJ03659.1| hypothetical protein PRUPE_ppa010106mg [Prunus persica] Length = 264 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGIY GD+ V+H TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIYVGDDTVVHFTRRGQ 48 >ref|XP_002873253.1| NC domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319090|gb|EFH49512.1| NC domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 259 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 350 PGDHIYSWRTAYIYAHHGIYFGDNKVIHLTRHGQ 249 PGDHIYSWRTAYIYAHHGI+ GD++V+H TR GQ Sbjct: 15 PGDHIYSWRTAYIYAHHGIFVGDDRVVHFTRRGQ 48