BLASTX nr result
ID: Paeonia22_contig00025101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00025101 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 64 1e-12 ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 64 1e-12 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 64 1e-12 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 64 1e-12 ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, part... 64 2e-12 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 64.3 bits (155), Expect(2) = 1e-12 Identities = 26/57 (45%), Positives = 40/57 (70%) Frame = +3 Query: 144 TWWKSHRKHHRI*SLM*KEFKCHLRKKLNLIGYKEEIWYKWQHLKQKREKSVQDYST 314 TWWKS+++ + + L K FK LRK+ +GY++E WYKWQH +Q+ + VQ+Y+T Sbjct: 166 TWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHFRQRFGQHVQEYTT 222 Score = 34.3 bits (77), Expect(2) = 1e-12 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +2 Query: 2 IYNGAGDEQQLDGWLDNG*LDRLETYFSVY----IDALKLRKLNLSA 130 IY G D ++LD W+D LETYF+VY + +K L LS+ Sbjct: 121 IYKGDVDPEKLDNWVDT-----LETYFTVYKYSNVQKIKFASLKLSS 162 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 64.3 bits (155), Expect(2) = 1e-12 Identities = 26/57 (45%), Positives = 40/57 (70%) Frame = +3 Query: 144 TWWKSHRKHHRI*SLM*KEFKCHLRKKLNLIGYKEEIWYKWQHLKQKREKSVQDYST 314 TWWKS+++ + + L K FK LRK+ +GY++E WYKWQH +Q+ + VQ+Y+T Sbjct: 95 TWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHFRQRFGQHVQEYTT 151 Score = 34.3 bits (77), Expect(2) = 1e-12 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +2 Query: 2 IYNGAGDEQQLDGWLDNG*LDRLETYFSVY----IDALKLRKLNLSA 130 IY G D ++LD W+D LETYF+VY + +K L LS+ Sbjct: 50 IYKGDVDPEKLDNWVDT-----LETYFTVYKYSNVQKIKFASLKLSS 91 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 64.3 bits (155), Expect(2) = 1e-12 Identities = 26/57 (45%), Positives = 40/57 (70%) Frame = +3 Query: 144 TWWKSHRKHHRI*SLM*KEFKCHLRKKLNLIGYKEEIWYKWQHLKQKREKSVQDYST 314 TWWKS+++ + + L K FK LRK+ +GY++E WYKWQH +Q+ + VQ+Y+T Sbjct: 176 TWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHFRQRFGQHVQEYTT 232 Score = 33.9 bits (76), Expect(2) = 1e-12 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +2 Query: 2 IYNGAGDEQQLDGWLDNG*LDRLETYFSVY----IDALKLRKLNLSA 130 IY G D ++LD W+D LETYF+VY + +K L LS+ Sbjct: 131 IYKGDIDPEKLDNWVDT-----LETYFTVYKYSNVQKIKFASLKLSS 172 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 64.3 bits (155), Expect(2) = 1e-12 Identities = 26/57 (45%), Positives = 40/57 (70%) Frame = +3 Query: 144 TWWKSHRKHHRI*SLM*KEFKCHLRKKLNLIGYKEEIWYKWQHLKQKREKSVQDYST 314 TWWKS+++ + + L K FK LRK+ +GY++E WYKWQH +Q+ + VQ+Y+T Sbjct: 166 TWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHFRQRFGQHVQEYTT 222 Score = 33.9 bits (76), Expect(2) = 1e-12 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +2 Query: 2 IYNGAGDEQQLDGWLDNG*LDRLETYFSVY----IDALKLRKLNLSA 130 IY G D ++LD W+D LETYF+VY + +K L LS+ Sbjct: 121 IYKGDIDPEKLDNWVDT-----LETYFTVYKYSNVQKIKFASLKLSS 162 >ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] gi|462416825|gb|EMJ21562.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] Length = 373 Score = 64.3 bits (155), Expect(2) = 2e-12 Identities = 26/57 (45%), Positives = 40/57 (70%) Frame = +3 Query: 144 TWWKSHRKHHRI*SLM*KEFKCHLRKKLNLIGYKEEIWYKWQHLKQKREKSVQDYST 314 TWWKS+++ + + L K FK LRK+ +GY++E WYKWQH +Q+ + VQ+Y+T Sbjct: 54 TWWKSYQRRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHFRQRFGQHVQEYTT 110 Score = 33.5 bits (75), Expect(2) = 2e-12 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +2 Query: 2 IYNGAGDEQQLDGWLDNG*LDRLETYFSVY----IDALKLRKLNLSA 130 IY G D ++LD W+D LETYF+VY + +K + LS+ Sbjct: 9 IYKGDVDPEKLDNWVDT-----LETYFTVYKYSNVQKIKFASMKLSS 50