BLASTX nr result
ID: Paeonia22_contig00024956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00024956 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHI48503.1| multidrug and toxic extrusion transporter [Vaccin... 55 8e-06 >gb|AHI48503.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum] Length = 518 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/34 (70%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -2 Query: 284 YRTNWNKEASIAGHRIKEWGGD-ESANKVNDVEK 186 YRTNWNKEASIAG+RI++WGG+ E +K ND+EK Sbjct: 485 YRTNWNKEASIAGNRIRQWGGEGEPDDKANDIEK 518