BLASTX nr result
ID: Paeonia22_contig00024518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00024518 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ72539.1| hypothetical protein A1O5_03685 [Cladophialophora... 84 3e-14 gb|EHY58178.1| MC family mitochondrial carrier protein [Exophial... 84 3e-14 gb|ETI28089.1| hypothetical protein G647_00538 [Cladophialophora... 79 7e-13 gb|ETN39374.1| hypothetical protein HMPREF1541_05597 [Cyphelloph... 78 1e-12 ref|XP_001399552.2| phosphate carrier protein 2 [Aspergillus nig... 77 2e-12 emb|CDM37126.1| Mitochondrial phosphate carrier protein 2 [Penic... 77 2e-12 gb|EXJ64161.1| hypothetical protein A1O7_00497 [Cladophialophora... 77 3e-12 gb|EGX45644.1| hypothetical protein AOL_s00169g250 [Arthrobotrys... 77 3e-12 gb|EWC47518.1| mitochondrial phosphate carrier protein 2 [Drechs... 76 4e-12 gb|EPS45991.1| hypothetical protein H072_27 [Dactylellina haptot... 75 1e-11 gb|EPS28259.1| hypothetical protein PDE_03205 [Penicillium oxali... 75 1e-11 ref|XP_002379506.1| mitochondrial phosphate transporter Pic2, pu... 74 2e-11 ref|XP_007589533.1| putative mitochondrial phosphate carrier pro... 73 4e-11 gb|EKV04046.1| Mitochondrial phosphate transporter Pic2, putativ... 73 4e-11 ref|XP_001588988.1| hypothetical protein SS1G_09621 [Sclerotinia... 73 4e-11 ref|XP_001558710.1| mitochondrial phosphate carrier protein [Bot... 73 4e-11 gb|EKG11100.1| Mitochondrial substrate/solute carrier [Macrophom... 72 6e-11 dbj|GAD94541.1| mitochondrial phosphate transporter Pic2, putati... 72 8e-11 gb|EMF13574.1| mitochondrial phosphate carrier protein [Sphaerul... 72 8e-11 ref|XP_002563917.1| Pc20g14390 [Penicillium chrysogenum Wisconsi... 72 8e-11 >gb|EXJ72539.1| hypothetical protein A1O5_03685 [Cladophialophora psammophila CBS 110553] Length = 317 Score = 83.6 bits (205), Expect = 3e-14 Identities = 44/69 (63%), Positives = 51/69 (73%) Frame = -3 Query: 212 ALQNPTKPLPSKKEIKRSFTDKSSCLLNEQTKYFASCMLGGIVACGPTHTLVTPLDLVKT 33 A Q KP PS + +K+ K + TKYFA+CMLGG+VACGPTHTLVTPLDLVKT Sbjct: 2 ATQTTLKP-PSAEVLKKYPLGK---IEPYSTKYFAACMLGGVVACGPTHTLVTPLDLVKT 57 Query: 32 RRQVDPKLY 6 RRQVDPK+Y Sbjct: 58 RRQVDPKIY 66 >gb|EHY58178.1| MC family mitochondrial carrier protein [Exophiala dermatitidis NIH/UT8656] Length = 319 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYFASCMLGG++ACGPTHTLVTPLDLVKTRRQVDPK+YT Sbjct: 31 KYFASCMLGGVIACGPTHTLVTPLDLVKTRRQVDPKMYT 69 >gb|ETI28089.1| hypothetical protein G647_00538 [Cladophialophora carrionii CBS 160.54] Length = 295 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 125 QTKYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLY 6 QTKYFA+CMLGGIVACGPTHTLVTPLDLVKTRRQV P +Y Sbjct: 5 QTKYFAACMLGGIVACGPTHTLVTPLDLVKTRRQVVPGIY 44 >gb|ETN39374.1| hypothetical protein HMPREF1541_05597 [Cyphellophora europaea CBS 101466] Length = 320 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 122 TKYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLY 6 TKYFA+CMLGG+VACGPTHTLVTPLDLVKTRRQV P +Y Sbjct: 31 TKYFAACMLGGVVACGPTHTLVTPLDLVKTRRQVSPGIY 69 >ref|XP_001399552.2| phosphate carrier protein 2 [Aspergillus niger CBS 513.88] Length = 307 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYFASC LGGI+ACGPTHT VTPLDLVK RRQVDPK+YT Sbjct: 19 KYFASCTLGGIIACGPTHTAVTPLDLVKCRRQVDPKIYT 57 >emb|CDM37126.1| Mitochondrial phosphate carrier protein 2 [Penicillium roqueforti] Length = 307 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYFASC LGG++ACGPTHT VTPLDLVK RRQVDPK+YT Sbjct: 19 KYFASCALGGVIACGPTHTAVTPLDLVKCRRQVDPKIYT 57 >gb|EXJ64161.1| hypothetical protein A1O7_00497 [Cladophialophora yegresii CBS 114405] Length = 318 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 122 TKYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLY 6 TKYFA+CMLGG+VACGPTHTLVTPLDLVKTRRQV P +Y Sbjct: 29 TKYFAACMLGGVVACGPTHTLVTPLDLVKTRRQVVPGIY 67 >gb|EGX45644.1| hypothetical protein AOL_s00169g250 [Arthrobotrys oligospora ATCC 24927] Length = 326 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLY 6 KYF SCMLGGIVACGPTHT VTPLDLVKTRRQVD KLY Sbjct: 37 KYFLSCMLGGIVACGPTHTFVTPLDLVKTRRQVDSKLY 74 >gb|EWC47518.1| mitochondrial phosphate carrier protein 2 [Drechslerella stenobrocha 248] Length = 317 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLY 6 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQV+ LY Sbjct: 28 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVNSSLY 65 >gb|EPS45991.1| hypothetical protein H072_27 [Dactylellina haptotyla CBS 200.50] Length = 537 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 122 TKYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLY 6 +KY+A+CMLGGIVACGPTHT VTPLDLVKTRRQVD LY Sbjct: 24 SKYYAACMLGGIVACGPTHTFVTPLDLVKTRRQVDSSLY 62 >gb|EPS28259.1| hypothetical protein PDE_03205 [Penicillium oxalicum 114-2] Length = 307 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYF SC LGGI+ACGPTHT VTPLDLVK RRQVDPK+YT Sbjct: 19 KYFLSCGLGGIIACGPTHTAVTPLDLVKCRRQVDPKIYT 57 >ref|XP_002379506.1| mitochondrial phosphate transporter Pic2, putative [Aspergillus flavus NRRL3357] gi|317147112|ref|XP_001821891.2| phosphate carrier protein 2 [Aspergillus oryzae RIB40] gi|220694386|gb|EED50730.1| mitochondrial phosphate transporter Pic2, putative [Aspergillus flavus NRRL3357] gi|391868865|gb|EIT78074.1| phosphate carrier protein [Aspergillus oryzae 3.042] Length = 307 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYF +C LGGI+ACGPTHT VTPLDLVK RRQVDPK+YT Sbjct: 19 KYFVNCALGGIIACGPTHTSVTPLDLVKCRRQVDPKIYT 57 >ref|XP_007589533.1| putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] gi|485915306|gb|EOD42994.1| putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] Length = 264 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 116 YFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 YFA+C +GG++ACGPTHT VTPLDLVK RRQVDPK+YT Sbjct: 22 YFAACTIGGVIACGPTHTAVTPLDLVKCRRQVDPKIYT 59 >gb|EKV04046.1| Mitochondrial phosphate transporter Pic2, putative [Penicillium digitatum Pd1] gi|425766826|gb|EKV05423.1| Mitochondrial phosphate transporter Pic2, putative [Penicillium digitatum PHI26] Length = 307 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYF SC GGI+ACGPTHT VTPLDLVK RRQVDPK+YT Sbjct: 19 KYFLSCGFGGIIACGPTHTAVTPLDLVKCRRQVDPKIYT 57 >ref|XP_001588988.1| hypothetical protein SS1G_09621 [Sclerotinia sclerotiorum 1980] gi|154694016|gb|EDN93754.1| hypothetical protein SS1G_09621 [Sclerotinia sclerotiorum 1980 UF-70] Length = 307 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYFA+C LGGI+ACGPTHT VTPLDLVK RRQVD KLYT Sbjct: 19 KYFAACGLGGIIACGPTHTAVTPLDLVKCRRQVDSKLYT 57 >ref|XP_001558710.1| mitochondrial phosphate carrier protein [Botryotinia fuckeliana B05.10] gi|347830566|emb|CCD46263.1| similar to mitochondrial phosphate carrier protein [Botryotinia fuckeliana T4] gi|472243303|gb|EMR87960.1| putative mitochondrial phosphate carrier protein [Botryotinia fuckeliana BcDW1] Length = 307 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYFA+C LGGI+ACGPTHT VTPLDLVK RRQVD KLYT Sbjct: 19 KYFAACGLGGIIACGPTHTAVTPLDLVKCRRQVDSKLYT 57 >gb|EKG11100.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 309 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 116 YFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 YFA+C LGG++ACGPTHT VTPLDLVK RRQVDPK+Y+ Sbjct: 22 YFAACTLGGVIACGPTHTAVTPLDLVKCRRQVDPKIYS 59 >dbj|GAD94541.1| mitochondrial phosphate transporter Pic2, putative [Byssochlamys spectabilis No. 5] Length = 308 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 122 TKYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLY 6 ++YFASC LGGI+ACGPTHT VTPLDLVK RRQVDP +Y Sbjct: 19 SQYFASCALGGIIACGPTHTSVTPLDLVKCRRQVDPNIY 57 >gb|EMF13574.1| mitochondrial phosphate carrier protein [Sphaerulina musiva SO2202] Length = 314 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 116 YFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 YFA+C LGGI+ACGPTHT VTPLDLVK RRQVD KLYT Sbjct: 27 YFAACTLGGIIACGPTHTAVTPLDLVKCRRQVDSKLYT 64 >ref|XP_002563917.1| Pc20g14390 [Penicillium chrysogenum Wisconsin 54-1255] gi|211588652|emb|CAP86768.1| Pc20g14390 [Penicillium chrysogenum Wisconsin 54-1255] Length = 307 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 119 KYFASCMLGGIVACGPTHTLVTPLDLVKTRRQVDPKLYT 3 KYF SC +GGI+ACGPTHT VTPLDLVK RRQVDPK+Y+ Sbjct: 19 KYFLSCGVGGIIACGPTHTAVTPLDLVKCRRQVDPKIYS 57