BLASTX nr result
ID: Paeonia22_contig00024486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00024486 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23139.1| hypothetical protein MIMGU_mgv1a003675mg [Mimulus... 63 4e-08 ref|XP_006398845.1| hypothetical protein EUTSA_v10015335mg [Eutr... 63 4e-08 gb|AAK61844.1| malate synthase [Anigozanthos flavidus] 63 4e-08 gb|EXB94822.1| Malate synthase [Morus notabilis] 62 8e-08 emb|CAA73793.1| glyoxysomal malate synthase [Brassica napus] 62 8e-08 sp|P45458.1|MASY_SOYBN RecName: Full=Malate synthase, glyoxysoma... 62 8e-08 ref|NP_196006.1| malate synthase [Arabidopsis thaliana] gi|33418... 62 8e-08 sp|P13244.1|MASY_BRANA RecName: Full=Malate synthase, glyoxysoma... 62 8e-08 ref|XP_006351487.1| PREDICTED: malate synthase, glyoxysomal-like... 62 8e-08 ref|XP_006286626.1| hypothetical protein CARUB_v10002436mg [Caps... 62 8e-08 ref|XP_004297548.1| PREDICTED: malate synthase, glyoxysomal-like... 62 8e-08 ref|XP_007209101.1| hypothetical protein PRUPE_ppa003648mg [Prun... 62 8e-08 ref|XP_004172563.1| PREDICTED: malate synthase, glyoxysomal-like... 62 8e-08 ref|XP_004152519.1| PREDICTED: malate synthase, glyoxysomal-like... 62 8e-08 sp|Q43827.1|MASY_RAPSA RecName: Full=Malate synthase, glyoxysoma... 62 8e-08 sp|P08216.2|MASY_CUCSA RecName: Full=Malate synthase, glyoxysoma... 62 8e-08 gb|AEQ54588.1| malate synthase, partial [Licuala spinosa] 62 8e-08 gb|AEQ54583.1| malate synthase, partial [Licuala paludosa] 62 8e-08 gb|AEQ54560.1| malate synthase, partial [Johannesteijsmannia per... 62 8e-08 ref|XP_006600799.1| PREDICTED: malate synthase, glyoxysomal [Gly... 62 8e-08 >gb|EYU23139.1| hypothetical protein MIMGU_mgv1a003675mg [Mimulus guttatus] Length = 570 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH +GLN GRWDYIF Y KTFQSHPDRLLP R Sbjct: 287 LRDHSIGLNCGRWDYIFSYIKTFQSHPDRLLPDR 320 >ref|XP_006398845.1| hypothetical protein EUTSA_v10015335mg [Eutrema salsugineum] gi|557099935|gb|ESQ40298.1| hypothetical protein EUTSA_v10015335mg [Eutrema salsugineum] Length = 562 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQSHPDRLLP R Sbjct: 279 LRDHSVGLNCGRWDYIFSYVKTFQSHPDRLLPDR 312 >gb|AAK61844.1| malate synthase [Anigozanthos flavidus] Length = 330 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQSHPDRLLP R Sbjct: 128 LRDHSVGLNCGRWDYIFSYVKTFQSHPDRLLPDR 161 >gb|EXB94822.1| Malate synthase [Morus notabilis] Length = 572 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 288 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 321 >emb|CAA73793.1| glyoxysomal malate synthase [Brassica napus] Length = 561 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 279 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 312 >sp|P45458.1|MASY_SOYBN RecName: Full=Malate synthase, glyoxysomal; Short=MS gi|170026|gb|AAC37465.1| malate synthase, partial [Glycine max] Length = 564 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 281 LKDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 314 >ref|NP_196006.1| malate synthase [Arabidopsis thaliana] gi|334187411|ref|NP_001190219.1| malate synthase [Arabidopsis thaliana] gi|13430428|gb|AAK25836.1|AF360126_1 putative malate synthase [Arabidopsis thaliana] gi|7406396|emb|CAB85506.1| malate synthase-like protein [Arabidopsis thaliana] gi|9758015|dbj|BAB08612.1| malate synthase-like protein [Arabidopsis thaliana] gi|15293187|gb|AAK93704.1| putative malate synthase [Arabidopsis thaliana] gi|332003280|gb|AED90663.1| malate synthase [Arabidopsis thaliana] gi|332003281|gb|AED90664.1| malate synthase [Arabidopsis thaliana] Length = 562 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 279 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 312 >sp|P13244.1|MASY_BRANA RecName: Full=Malate synthase, glyoxysomal gi|167150|gb|AAA32996.1| malate synthase (EC 4.1.3.2) [Brassica napus] Length = 561 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 279 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 312 >ref|XP_006351487.1| PREDICTED: malate synthase, glyoxysomal-like [Solanum tuberosum] Length = 572 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ HPDRLLP R Sbjct: 289 LRDHSVGLNCGRWDYIFSYIKTFQGHPDRLLPDR 322 >ref|XP_006286626.1| hypothetical protein CARUB_v10002436mg [Capsella rubella] gi|482555332|gb|EOA19524.1| hypothetical protein CARUB_v10002436mg [Capsella rubella] Length = 562 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 279 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 312 >ref|XP_004297548.1| PREDICTED: malate synthase, glyoxysomal-like [Fragaria vesca subsp. vesca] Length = 567 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 284 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 317 >ref|XP_007209101.1| hypothetical protein PRUPE_ppa003648mg [Prunus persica] gi|462404836|gb|EMJ10300.1| hypothetical protein PRUPE_ppa003648mg [Prunus persica] Length = 559 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ HPDRLLP R Sbjct: 275 LRDHSVGLNCGRWDYIFSYIKTFQGHPDRLLPDR 308 >ref|XP_004172563.1| PREDICTED: malate synthase, glyoxysomal-like, partial [Cucumis sativus] Length = 450 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 167 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 200 >ref|XP_004152519.1| PREDICTED: malate synthase, glyoxysomal-like [Cucumis sativus] Length = 568 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 285 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 318 >sp|Q43827.1|MASY_RAPSA RecName: Full=Malate synthase, glyoxysomal gi|474172|emb|CAA55407.1| malate synthase [Raphanus sativus] Length = 566 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 281 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 314 >sp|P08216.2|MASY_CUCSA RecName: Full=Malate synthase, glyoxysomal gi|18271|emb|CAA33465.1| malate synthase [Cucumis sativus] Length = 568 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 285 LRDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 318 >gb|AEQ54588.1| malate synthase, partial [Licuala spinosa] Length = 205 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH +GLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 50 LRDHSIGLNCGRWDYIFSYVKTFQAHPDRLLPNR 83 >gb|AEQ54583.1| malate synthase, partial [Licuala paludosa] Length = 208 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH +GLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 53 LRDHSIGLNCGRWDYIFSYVKTFQAHPDRLLPNR 86 >gb|AEQ54560.1| malate synthase, partial [Johannesteijsmannia perakensis] Length = 210 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH +GLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 53 LRDHSIGLNCGRWDYIFNYVKTFQAHPDRLLPDR 86 >ref|XP_006600799.1| PREDICTED: malate synthase, glyoxysomal [Glycine max] Length = 567 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 185 LLDHYVGLNYGRWDYIFRYFKTFQSHPDRLLPGR 286 L DH VGLN GRWDYIF Y KTFQ+HPDRLLP R Sbjct: 284 LKDHSVGLNCGRWDYIFSYVKTFQAHPDRLLPDR 317