BLASTX nr result
ID: Paeonia22_contig00023856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00023856 (647 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162499.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU... 57 4e-06 ref|XP_004136459.1| PREDICTED: DDB1- and CUL4-associated factor ... 57 4e-06 >ref|XP_004162499.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor homolog 1-like [Cucumis sativus] Length = 1900 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 535 YPHVFEDDVLENIKKWVMDENAIISDEDYNWEMDLG 642 YPHVFE+DVLENIKKWVM+E S ED NW+ +LG Sbjct: 158 YPHVFEEDVLENIKKWVMEEAGKSSAEDRNWKPELG 193 >ref|XP_004136459.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Cucumis sativus] Length = 1915 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 535 YPHVFEDDVLENIKKWVMDENAIISDEDYNWEMDLG 642 YPHVFE+DVLENIKKWVM+E S ED NW+ +LG Sbjct: 153 YPHVFEEDVLENIKKWVMEEAGKSSAEDRNWKPELG 188