BLASTX nr result
ID: Paeonia22_contig00023818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00023818 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301585.1| PREDICTED: nuclear pore complex protein Nup9... 58 2e-06 ref|XP_006341370.1| PREDICTED: nuclear pore complex protein Nup9... 57 4e-06 ref|XP_004235924.1| PREDICTED: nuclear pore complex protein Nup9... 57 4e-06 ref|XP_007023385.1| Suppressor of auxin resistance 3 [Theobroma ... 56 8e-06 ref|XP_003544079.1| PREDICTED: nuclear pore complex protein Nup9... 55 1e-05 >ref|XP_004301585.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like [Fragaria vesca subsp. vesca] Length = 1089 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 108 RHIKIWKLANSMDNHKLEIEDWDLGDGIYISLYVTR 1 +H IW+LA SM++HK EIE+WDLG GIYIS Y+TR Sbjct: 944 KHSDIWRLATSMEDHKSEIENWDLGAGIYISFYLTR 979 >ref|XP_006341370.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like [Solanum tuberosum] Length = 1033 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 105 HIKIWKLANSMDNHKLEIEDWDLGDGIYISLYVTR 1 H +IW+LA SM++HK EIEDWDLG GIYIS Y+ R Sbjct: 890 HSEIWRLAASMEDHKSEIEDWDLGAGIYISFYLLR 924 >ref|XP_004235924.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like [Solanum lycopersicum] Length = 1012 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 105 HIKIWKLANSMDNHKLEIEDWDLGDGIYISLYVTR 1 H +IW+LA SM++HK EIEDWDLG GIYIS Y+ R Sbjct: 869 HSEIWRLAASMEDHKSEIEDWDLGAGIYISFYLLR 903 >ref|XP_007023385.1| Suppressor of auxin resistance 3 [Theobroma cacao] gi|508778751|gb|EOY26007.1| Suppressor of auxin resistance 3 [Theobroma cacao] Length = 1069 Score = 55.8 bits (133), Expect = 8e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -2 Query: 105 HIKIWKLANSMDNHKLEIEDWDLGDGIYISLYVTR 1 H ++W++A SM++HK EIE+WDLG GIYIS YV R Sbjct: 925 HSEVWRIATSMEDHKSEIENWDLGAGIYISFYVVR 959 >ref|XP_003544079.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like isoform X1 [Glycine max] gi|571506071|ref|XP_006595657.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like isoform X2 [Glycine max] Length = 1022 Score = 55.5 bits (132), Expect = 1e-05 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = -2 Query: 126 RANVRGRHIKIWKLANSMDNHKLEIEDWDLGDGIYISLYVTR 1 R ++ +H +IW++A SM++HK EIE+W+LG GIYIS Y+ R Sbjct: 871 RLFLQAKHAEIWRIATSMEDHKSEIENWELGAGIYISFYLMR 912