BLASTX nr result
ID: Paeonia22_contig00023766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00023766 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 55 8e-06 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 55 8e-06 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 272 MHTYSLVNAEYLKLFEPPLLDDDSNEETRLPSI*D 168 MH YS++NAE LKLFEP LLDDD E+TRLPS+ D Sbjct: 1369 MHMYSVINAENLKLFEPSLLDDDPEEDTRLPSVDD 1403 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 272 MHTYSLVNAEYLKLFEPPLLDDDSNEETRLPSI*D 168 MH YS++NAE LKLFEP LLDDD E+TRLPS+ D Sbjct: 1403 MHMYSVINAENLKLFEPSLLDDDPEEDTRLPSVDD 1437