BLASTX nr result
ID: Paeonia22_contig00023494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00023494 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Popu... 60 3e-07 >ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] gi|550344355|gb|EEE80134.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] Length = 979 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -3 Query: 190 RTAIREIPTSLSLLPKLTYLGLNECKRLEEILGVPKSLVTLEARDCTALERINLKNFNEK 11 R +P S+ LPKLT L LNECK L+ I + SL L A+DC +LE INLKNF + Sbjct: 605 RNNFTSLPASIGSLPKLTRLWLNECKSLQCIPELQSSLQLLHAKDCLSLETINLKNFWGE 664 Query: 10 GSL 2 G+L Sbjct: 665 GTL 667