BLASTX nr result
ID: Paeonia22_contig00023176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00023176 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006452002.1| hypothetical protein CICLE_v10010507mg [Citr... 74 2e-11 ref|XP_007021255.1| Cyclic nucleotide-gated ion channel 4 isofor... 74 2e-11 ref|XP_007021254.1| Cyclic nucleotide-gated ion channel 4 isofor... 74 2e-11 gb|EXB89632.1| hypothetical protein L484_018733 [Morus notabilis] 73 5e-11 ref|XP_006370343.1| hypothetical protein POPTR_0001s41830g [Popu... 72 6e-11 ref|XP_003634689.1| PREDICTED: cyclic nucleotide-gated ion chann... 71 1e-10 ref|XP_003526201.1| PREDICTED: cyclic nucleotide-gated ion chann... 70 2e-10 ref|XP_007213607.1| hypothetical protein PRUPE_ppa002333mg [Prun... 70 3e-10 ref|XP_006280134.1| hypothetical protein CARUB_v10026031mg [Caps... 70 4e-10 ref|XP_006280133.1| hypothetical protein CARUB_v10026031mg [Caps... 70 4e-10 ref|XP_002525760.1| Cyclic nucleotide-gated ion channel, putativ... 70 4e-10 ref|XP_003541002.1| PREDICTED: cyclic nucleotide-gated ion chann... 69 5e-10 ref|XP_004294484.1| PREDICTED: cyclic nucleotide-gated ion chann... 69 9e-10 ref|NP_200236.1| cyclic nucleotide-gated ion channel 4 [Arabidop... 67 2e-09 ref|XP_007132934.1| hypothetical protein PHAVU_011G137200g [Phas... 67 2e-09 gb|AGV54453.1| cyclic nucleotide-gated ion channel 4-like protei... 67 2e-09 gb|AAK76496.1| putative cyclic nucleotide and calmodulin-regulat... 67 2e-09 ref|NP_001190536.1| cyclic nucleotide-gated ion channel 4 [Arabi... 67 2e-09 ref|XP_002866035.1| ATCNGC4 [Arabidopsis lyrata subsp. lyrata] g... 67 2e-09 ref|XP_006367652.1| PREDICTED: cyclic nucleotide-gated ion chann... 66 6e-09 >ref|XP_006452002.1| hypothetical protein CICLE_v10010507mg [Citrus clementina] gi|568820315|ref|XP_006464668.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Citrus sinensis] gi|557555228|gb|ESR65242.1| hypothetical protein CICLE_v10010507mg [Citrus clementina] Length = 695 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 149 RRKSKYGNFCTPRSKQ-FSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 RR+ + C R + +S G+VLDPRAKWVQEWNRVFLLVCATGLFVDP Sbjct: 55 RRRDMFSGICGRRRRSNWSFGQVLDPRAKWVQEWNRVFLLVCATGLFVDP 104 >ref|XP_007021255.1| Cyclic nucleotide-gated ion channel 4 isoform 2 [Theobroma cacao] gi|508720883|gb|EOY12780.1| Cyclic nucleotide-gated ion channel 4 isoform 2 [Theobroma cacao] Length = 658 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 122 CTPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 C R + +SLG+VLDPRAKWVQEWNRVFLLVCATGLFVDP Sbjct: 187 CGRRRRGWSLGQVLDPRAKWVQEWNRVFLLVCATGLFVDP 226 >ref|XP_007021254.1| Cyclic nucleotide-gated ion channel 4 isoform 1 [Theobroma cacao] gi|508720882|gb|EOY12779.1| Cyclic nucleotide-gated ion channel 4 isoform 1 [Theobroma cacao] Length = 823 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 122 CTPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 C R + +SLG+VLDPRAKWVQEWNRVFLLVCATGLFVDP Sbjct: 187 CGRRRRGWSLGQVLDPRAKWVQEWNRVFLLVCATGLFVDP 226 >gb|EXB89632.1| hypothetical protein L484_018733 [Morus notabilis] Length = 711 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 113 RSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 R K +SLG VLDPRAKWVQEWNRVFLLVCATGLFVDP Sbjct: 66 RRKGWSLGHVLDPRAKWVQEWNRVFLLVCATGLFVDP 102 >ref|XP_006370343.1| hypothetical protein POPTR_0001s41830g [Populus trichocarpa] gi|550349522|gb|ERP66912.1| hypothetical protein POPTR_0001s41830g [Populus trichocarpa] Length = 716 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/49 (71%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = -2 Query: 143 KSKYGNFCTPRSKQ--FSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 K + N C SK+ +SLG+VLDPR KWVQEWNRVFLLVCATGLFVDP Sbjct: 80 KGMFLNLCGGGSKRRGWSLGQVLDPRGKWVQEWNRVFLLVCATGLFVDP 128 >ref|XP_003634689.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Vitis vinifera] Length = 667 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -2 Query: 146 RKSKYGNFCTPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 R+ YG C+ K L RVLDPRAKWVQEWNRVFLLVCATGLFVDP Sbjct: 37 REPLYGR-CSSGLKPKCLSRVLDPRAKWVQEWNRVFLLVCATGLFVDP 83 >ref|XP_003526201.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Glycine max] Length = 691 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -2 Query: 119 TPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 T RS +LGRVLDPRAKWVQEWNRVFLLVCA GLFVDP Sbjct: 58 TRRSGGGALGRVLDPRAKWVQEWNRVFLLVCAAGLFVDP 96 >ref|XP_007213607.1| hypothetical protein PRUPE_ppa002333mg [Prunus persica] gi|462409472|gb|EMJ14806.1| hypothetical protein PRUPE_ppa002333mg [Prunus persica] Length = 686 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 113 RSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 RS +SLG+VLDPRAKWVQEWNRVFLLVCATGL +DP Sbjct: 58 RSPGWSLGQVLDPRAKWVQEWNRVFLLVCATGLIIDP 94 >ref|XP_006280134.1| hypothetical protein CARUB_v10026031mg [Capsella rubella] gi|482548838|gb|EOA13032.1| hypothetical protein CARUB_v10026031mg [Capsella rubella] Length = 508 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 110 SKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 +K LGR+LDPR+KWVQEWNRVFLLVCATGLFVDP Sbjct: 82 NKWMMLGRILDPRSKWVQEWNRVFLLVCATGLFVDP 117 >ref|XP_006280133.1| hypothetical protein CARUB_v10026031mg [Capsella rubella] gi|482548837|gb|EOA13031.1| hypothetical protein CARUB_v10026031mg [Capsella rubella] Length = 669 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 110 SKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 +K LGR+LDPR+KWVQEWNRVFLLVCATGLFVDP Sbjct: 82 NKWMMLGRILDPRSKWVQEWNRVFLLVCATGLFVDP 117 >ref|XP_002525760.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223534910|gb|EEF36596.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 687 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 113 RSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 RS +SLG+VLDPRAKWVQEWNR FLLVCATGLFVDP Sbjct: 62 RSGGWSLGQVLDPRAKWVQEWNRGFLLVCATGLFVDP 98 >ref|XP_003541002.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Glycine max] Length = 690 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 113 RSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 RS +LGRVLDPRAKWVQEWNRVFLLVCA GLFVDP Sbjct: 61 RSGGGALGRVLDPRAKWVQEWNRVFLLVCAAGLFVDP 97 >ref|XP_004294484.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Fragaria vesca subsp. vesca] Length = 692 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 113 RSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 R +SLG+VLDPRAKWVQEWNRVFLLVCATGL +DP Sbjct: 67 RRPSWSLGQVLDPRAKWVQEWNRVFLLVCATGLVIDP 103 >ref|NP_200236.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana] gi|30696428|ref|NP_851188.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana] gi|38503128|sp|Q94AS9.2|CNGC4_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 4; Short=AtCNGC4; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 4; Short=AtHLM1 gi|4581203|emb|CAB40129.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|9759498|dbj|BAB10748.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|16323174|gb|AAL15321.1| AT5g54250/MDK4_7 [Arabidopsis thaliana] gi|222423088|dbj|BAH19524.1| AT5G54250 [Arabidopsis thaliana] gi|332009090|gb|AED96473.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana] gi|332009091|gb|AED96474.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana] Length = 694 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 128 NFCTPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 N + +K LGR+LDPR+KWV+EWN+VFLLVCATGLFVDP Sbjct: 65 NGSSNNNKWMMLGRILDPRSKWVREWNKVFLLVCATGLFVDP 106 >ref|XP_007132934.1| hypothetical protein PHAVU_011G137200g [Phaseolus vulgaris] gi|561005934|gb|ESW04928.1| hypothetical protein PHAVU_011G137200g [Phaseolus vulgaris] Length = 773 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 98 SLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 +LG+VLDPRAKWVQEWNRVFLLVCA GLFVDP Sbjct: 158 TLGKVLDPRAKWVQEWNRVFLLVCAAGLFVDP 189 >gb|AGV54453.1| cyclic nucleotide-gated ion channel 4-like protein [Phaseolus vulgaris] Length = 678 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 98 SLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 +LG+VLDPRAKWVQEWNRVFLLVCA GLFVDP Sbjct: 65 TLGKVLDPRAKWVQEWNRVFLLVCAAGLFVDP 96 >gb|AAK76496.1| putative cyclic nucleotide and calmodulin-regulated ion channel protein [Arabidopsis thaliana] gi|22136698|gb|AAM91668.1| putative cyclic nucleotide and calmodulin-regulated ion channel protein [Arabidopsis thaliana] Length = 293 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 128 NFCTPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 N + +K LGR+LDPR+KWV+EWN+VFLLVCATGLFVDP Sbjct: 65 NGSSNNNKWMMLGRILDPRSKWVREWNKVFLLVCATGLFVDP 106 >ref|NP_001190536.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana] gi|332009092|gb|AED96475.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana] Length = 689 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 128 NFCTPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 N + +K LGR+LDPR+KWV+EWN+VFLLVCATGLFVDP Sbjct: 65 NGSSNNNKWMMLGRILDPRSKWVREWNKVFLLVCATGLFVDP 106 >ref|XP_002866035.1| ATCNGC4 [Arabidopsis lyrata subsp. lyrata] gi|297311870|gb|EFH42294.1| ATCNGC4 [Arabidopsis lyrata subsp. lyrata] Length = 694 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 128 NFCTPRSKQFSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 N + +K LGR+LDPR+KWV+EWN+VFLLVCATGLFVDP Sbjct: 65 NGSSNNNKWMMLGRILDPRSKWVREWNKVFLLVCATGLFVDP 106 >ref|XP_006367652.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Solanum tuberosum] Length = 688 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 5/47 (10%) Frame = -2 Query: 128 NFCTPRSKQ-----FSLGRVLDPRAKWVQEWNRVFLLVCATGLFVDP 3 N C+ RS++ F +V+DPRA WVQEWNRVFLLVCATGLFVDP Sbjct: 47 NICSGRSRRGGLTDFFSWKVIDPRAPWVQEWNRVFLLVCATGLFVDP 93