BLASTX nr result
ID: Paeonia22_contig00023163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00023163 (608 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007013742.1| Pentatricopeptide repeat-containing protein ... 60 5e-07 ref|XP_007013741.1| Pentatricopeptide repeat-containing protein ... 60 5e-07 ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 58 2e-06 >ref|XP_007013742.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] gi|508784105|gb|EOY31361.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] Length = 720 Score = 60.1 bits (144), Expect = 5e-07 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = -3 Query: 219 RENRIEEVL*HLNCFDWVVNGPGMVSFNTLLATAYKRGNSSVAHKIWCIMEYAVLELNV 43 RE I E L L+ F+W NGP +VSFNT+L+TA + GNS++ I C MEY ++L+V Sbjct: 446 RERNINEALELLDHFEWDANGPDVVSFNTILSTACRLGNSAIIQSILCRMEYEHIKLDV 504 >ref|XP_007013741.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508784104|gb|EOY31360.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 761 Score = 60.1 bits (144), Expect = 5e-07 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = -3 Query: 219 RENRIEEVL*HLNCFDWVVNGPGMVSFNTLLATAYKRGNSSVAHKIWCIMEYAVLELNV 43 RE I E L L+ F+W NGP +VSFNT+L+TA + GNS++ I C MEY ++L+V Sbjct: 446 RERNINEALELLDHFEWDANGPDVVSFNTILSTACRLGNSAIIQSILCRMEYEHIKLDV 504 >ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Vitis vinifera] Length = 629 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/59 (47%), Positives = 40/59 (67%) Frame = -3 Query: 219 RENRIEEVL*HLNCFDWVVNGPGMVSFNTLLATAYKRGNSSVAHKIWCIMEYAVLELNV 43 REN I+E L + F+W N P +VSFNT+L+ A K+GNSS+ ++ MEY ++LNV Sbjct: 337 RENHIDEALQLFDHFEWANNSPDVVSFNTILSAACKQGNSSMIRRVLYRMEYEGVKLNV 395 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/59 (47%), Positives = 40/59 (67%) Frame = -3 Query: 219 RENRIEEVL*HLNCFDWVVNGPGMVSFNTLLATAYKRGNSSVAHKIWCIMEYAVLELNV 43 REN I+E L + F+W N P +VSFNT+L+ A K+GNSS+ ++ MEY ++LNV Sbjct: 445 RENHIDEALQLFDHFEWANNSPDVVSFNTILSAACKQGNSSMIRRVLYRMEYEGVKLNV 503