BLASTX nr result
ID: Paeonia22_contig00023102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00023102 (1012 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512785.1| acetyl-CoA synthetase, putative [Ricinus com... 50 1e-07 ref|XP_003624558.1| Acetyl-coenzyme A synthetase [Medicago trunc... 49 7e-07 ref|XP_002320403.2| hypothetical protein POPTR_0014s13710g [Popu... 50 7e-07 ref|XP_004145625.1| PREDICTED: acetate--CoA ligase ACS, chloropl... 50 9e-07 ref|XP_004172698.1| PREDICTED: acetate--CoA ligase ACS, chloropl... 50 9e-07 gb|AHL44976.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshu... 49 1e-06 ref|XP_006285314.1| hypothetical protein CARUB_v10006697mg [Caps... 47 2e-06 emb|CAN68599.1| hypothetical protein VITISV_019712 [Vitis vinifera] 46 3e-06 ref|XP_002870488.1| AMP binding protein [Arabidopsis lyrata subs... 47 3e-06 ref|XP_007161784.1| hypothetical protein PHAVU_001G097800g [Phas... 47 6e-06 ref|XP_006844731.1| hypothetical protein AMTR_s00016p00254000 [A... 49 6e-06 gb|ACU21344.1| unknown [Glycine max] 58 7e-06 ref|XP_007217032.1| hypothetical protein PRUPE_ppa001641mg [Prun... 49 7e-06 ref|XP_003575051.1| PREDICTED: acetyl-coenzyme A synthetase, cyt... 45 7e-06 gb|EYU40916.1| hypothetical protein MIMGU_mgv1a016022mg [Mimulus... 57 9e-06 ref|XP_006433048.1| hypothetical protein CICLE_v10002819mg [Citr... 57 9e-06 gb|AFK39646.1| unknown [Medicago truncatula] 57 9e-06 ref|NP_001238140.1| uncharacterized protein LOC100499673 [Glycin... 57 9e-06 ref|XP_003591024.1| 40S ribosomal protein S24 [Medicago truncatu... 57 9e-06 >ref|XP_002512785.1| acetyl-CoA synthetase, putative [Ricinus communis] gi|223547796|gb|EEF49288.1| acetyl-CoA synthetase, putative [Ricinus communis] Length = 749 Score = 49.7 bits (117), Expect(2) = 1e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FSSESLA RI+DCKPKV+ITCNA+ Sbjct: 258 VFAGFSSESLAQRIVDCKPKVVITCNAV 285 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RGSKV+ LK++ AL +S KNG S G + Y Sbjct: 285 VKRGSKVIPLKDIVDAALVESAKNGVSVGVCLTY 318 >ref|XP_003624558.1| Acetyl-coenzyme A synthetase [Medicago truncatula] gi|355499573|gb|AES80776.1| Acetyl-coenzyme A synthetase [Medicago truncatula] Length = 748 Score = 48.9 bits (115), Expect(2) = 7e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FSSESL+ RI+DCKPKV+ITCNA+ Sbjct: 257 VFAGFSSESLSQRIIDCKPKVVITCNAV 284 Score = 32.0 bits (71), Expect(2) = 7e-07 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RGSKV+ LK++ A++ ST+NG S V Y Sbjct: 284 VKRGSKVIYLKDIVDTAINDSTQNGVSIDVCVTY 317 >ref|XP_002320403.2| hypothetical protein POPTR_0014s13710g [Populus trichocarpa] gi|550324142|gb|EEE98718.2| hypothetical protein POPTR_0014s13710g [Populus trichocarpa] Length = 736 Score = 49.7 bits (117), Expect(2) = 7e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FSSESLA RI+DCKPKV+ITCNA+ Sbjct: 255 VFAGFSSESLAQRIVDCKPKVVITCNAV 282 Score = 31.2 bits (69), Expect(2) = 7e-07 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RG+K ++LK++ AL++S KNG S + Y Sbjct: 282 VKRGAKAIHLKDIVDAALAESAKNGISVDVCLTY 315 >ref|XP_004145625.1| PREDICTED: acetate--CoA ligase ACS, chloroplastic/glyoxysomal-like [Cucumis sativus] Length = 804 Score = 49.7 bits (117), Expect(2) = 9e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FSSESLA RI+DCKPK++ITCNA+ Sbjct: 313 VFAGFSSESLAQRIIDCKPKIVITCNAV 340 Score = 30.8 bits (68), Expect(2) = 9e-07 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RGSK ++LK++ AL +S +NG S T + Y Sbjct: 340 VKRGSKAIHLKDIVDAALIESAQNGVSVATCLSY 373 >ref|XP_004172698.1| PREDICTED: acetate--CoA ligase ACS, chloroplastic/glyoxysomal-like [Cucumis sativus] Length = 449 Score = 49.7 bits (117), Expect(2) = 9e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FSSESLA RI+DCKPK++ITCNA+ Sbjct: 315 VFAGFSSESLAQRIIDCKPKIVITCNAV 342 Score = 30.8 bits (68), Expect(2) = 9e-07 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RGSK ++LK++ AL +S +NG S T + Y Sbjct: 342 VKRGSKAIHLKDIVDAALIESAQNGVSVATCLSY 375 >gb|AHL44976.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica] Length = 799 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FS+ESLA RI+DCKPKV+ITCNA+ Sbjct: 308 VFAGFSAESLAQRIMDCKPKVVITCNAV 335 Score = 31.2 bits (69), Expect(2) = 1e-06 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RGSK++ LK++ AL+ S +NGF+ + Y Sbjct: 335 VRRGSKIIYLKDIVDAALADSAQNGFAVDVCLTY 368 >ref|XP_006285314.1| hypothetical protein CARUB_v10006697mg [Capsella rubella] gi|482554019|gb|EOA18212.1| hypothetical protein CARUB_v10006697mg [Capsella rubella] Length = 693 Score = 47.4 bits (111), Expect(2) = 2e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FS++SLA RI+DCKPKV++TCNA+ Sbjct: 202 VFAGFSADSLAQRIIDCKPKVILTCNAV 229 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVYRLS 607 + RG K +NLK + AL +S+K+G S G + Y S Sbjct: 229 VKRGPKTINLKAIVDAALDQSSKDGVSVGVCLTYENS 265 >emb|CAN68599.1| hypothetical protein VITISV_019712 [Vitis vinifera] Length = 768 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FSSESLA RI+DCKPKV+IT NA+ Sbjct: 278 VFAGFSSESLAQRIVDCKPKVVITSNAV 305 Score = 32.7 bits (73), Expect(2) = 3e-06 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RGSKV++LK++ AL +S KNG S + Y Sbjct: 305 VKRGSKVISLKDIVDAALVESAKNGISVDACLTY 338 >ref|XP_002870488.1| AMP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297316324|gb|EFH46747.1| AMP binding protein [Arabidopsis lyrata subsp. lyrata] Length = 743 Score = 47.4 bits (111), Expect(2) = 3e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FS++SLA RI+DCKPKV++TCNA+ Sbjct: 252 VFAGFSADSLAQRIIDCKPKVILTCNAV 279 Score = 31.2 bits (69), Expect(2) = 3e-06 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RG K +NLK + AL +S+K+G S G + Y Sbjct: 279 VKRGPKTINLKAIVDAALDQSSKDGVSVGICLTY 312 >ref|XP_007161784.1| hypothetical protein PHAVU_001G097800g [Phaseolus vulgaris] gi|593797494|ref|XP_007161785.1| hypothetical protein PHAVU_001G097800g [Phaseolus vulgaris] gi|561035248|gb|ESW33778.1| hypothetical protein PHAVU_001G097800g [Phaseolus vulgaris] gi|561035249|gb|ESW33779.1| hypothetical protein PHAVU_001G097800g [Phaseolus vulgaris] Length = 751 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FS+E+LA RI+DCKPKV+ITCNA+ Sbjct: 260 VFAGFSAEALAQRIVDCKPKVVITCNAV 287 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVYRLS 607 + RG KV+NLK++ A+ S +NG S +VY S Sbjct: 287 VKRGPKVLNLKDIVDAAIKDSAQNGVSIDKCLVYENS 323 >ref|XP_006844731.1| hypothetical protein AMTR_s00016p00254000 [Amborella trichopoda] gi|548847202|gb|ERN06406.1| hypothetical protein AMTR_s00016p00254000 [Amborella trichopoda] Length = 706 Score = 49.3 bits (116), Expect(2) = 6e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FS+ESLA RI+DCKPKV+ITCNA+ Sbjct: 215 VFAGFSAESLAQRIIDCKPKVIITCNAV 242 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFS 637 + RGSK++ LK++ AL +S+KNG S Sbjct: 242 VRRGSKIIYLKDIVDSALVESSKNGTS 268 >gb|ACU21344.1| unknown [Glycine max] Length = 137 Score = 57.8 bits (138), Expect = 7e-06 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -1 Query: 364 MVDKVVTIRTIKCMTRRLLSRKQVVIDGLYPVRSNVSKTKLKHILDK 224 M DK VTIRT K MT RLLSRKQ+++D L+P R+NVSK +LK L + Sbjct: 1 MADKAVTIRTRKFMTNRLLSRKQLIVDVLHPGRANVSKAELKEKLGR 47 >ref|XP_007217032.1| hypothetical protein PRUPE_ppa001641mg [Prunus persica] gi|462413182|gb|EMJ18231.1| hypothetical protein PRUPE_ppa001641mg [Prunus persica] Length = 788 Score = 48.5 bits (114), Expect(2) = 7e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FS+ESLA RI+DCKPKV+ITCNA+ Sbjct: 297 VFAGFSAESLAQRIVDCKPKVVITCNAV 324 Score = 28.9 bits (63), Expect(2) = 7e-06 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RGSKV++LK++ AL +S+++G S + Y Sbjct: 324 VKRGSKVIHLKDIVDAALIESSQSGVSIDVCLTY 357 >ref|XP_003575051.1| PREDICTED: acetyl-coenzyme A synthetase, cytoplasmic [Brachypodium distachyon] Length = 705 Score = 45.4 bits (106), Expect(2) = 7e-06 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = -3 Query: 797 VFGSFSSESLAHRILDCKPKVLITCNAL 714 VF FS++SLA RI+DCKPKV++TCN++ Sbjct: 214 VFAGFSADSLAQRIVDCKPKVVLTCNSV 241 Score = 32.0 bits (71), Expect(2) = 7e-06 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -2 Query: 717 IMRGSKVVNLKEMSVIALSKSTKNGFSTGTFVVY 616 + RG+K + LK++ AL +S KNGFS G + Y Sbjct: 241 VKRGAKPILLKDIVDAALVESEKNGFSVGLCLTY 274 >gb|EYU40916.1| hypothetical protein MIMGU_mgv1a016022mg [Mimulus guttatus] Length = 137 Score = 57.4 bits (137), Expect = 9e-06 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = -1 Query: 364 MVDKVVTIRTIKCMTRRLLSRKQVVIDGLYPVRSNVSKTKLKHILDK 224 M DK VTIRT K MT RLLSRKQ VID L+P R NVSK +LK L + Sbjct: 1 MADKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRPNVSKAELKEKLSR 47 >ref|XP_006433048.1| hypothetical protein CICLE_v10002819mg [Citrus clementina] gi|568835345|ref|XP_006471733.1| PREDICTED: 40S ribosomal protein S24-1-like [Citrus sinensis] gi|557535170|gb|ESR46288.1| hypothetical protein CICLE_v10002819mg [Citrus clementina] Length = 134 Score = 57.4 bits (137), Expect = 9e-06 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 364 MVDKVVTIRTIKCMTRRLLSRKQVVIDGLYPVRSNVSKTKLKHIL 230 M DK VTIRT K MT RLLSRKQ VID L+P R+NVSK +LK L Sbjct: 1 MADKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKL 45 >gb|AFK39646.1| unknown [Medicago truncatula] Length = 137 Score = 57.4 bits (137), Expect = 9e-06 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 364 MVDKVVTIRTIKCMTRRLLSRKQVVIDGLYPVRSNVSKTKLKHIL 230 M DK VTIRT K MT RLLSRKQ VID L+P R+NVSK +LK L Sbjct: 1 MADKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKL 45 >ref|NP_001238140.1| uncharacterized protein LOC100499673 [Glycine max] gi|255625693|gb|ACU13191.1| unknown [Glycine max] Length = 137 Score = 57.4 bits (137), Expect = 9e-06 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -1 Query: 364 MVDKVVTIRTIKCMTRRLLSRKQVVIDGLYPVRSNVSKTKLKHILDK 224 M DK VTIRT K MT RLLSRKQ V+D L+P R+NVSK +LK L + Sbjct: 1 MADKAVTIRTRKFMTNRLLSRKQFVVDVLHPGRANVSKAELKEKLGR 47 >ref|XP_003591024.1| 40S ribosomal protein S24 [Medicago truncatula] gi|217075254|gb|ACJ85987.1| unknown [Medicago truncatula] gi|355480072|gb|AES61275.1| 40S ribosomal protein S24 [Medicago truncatula] gi|388501578|gb|AFK38855.1| unknown [Medicago truncatula] gi|388521723|gb|AFK48923.1| unknown [Medicago truncatula] Length = 137 Score = 57.4 bits (137), Expect = 9e-06 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 364 MVDKVVTIRTIKCMTRRLLSRKQVVIDGLYPVRSNVSKTKLKHIL 230 M DK VTIRT K MT RLLSRKQ VID L+P R+NVSK +LK L Sbjct: 1 MADKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKL 45