BLASTX nr result
ID: Paeonia22_contig00022883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00022883 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536123.1| PREDICTED: pentatricopeptide repeat-containi... 115 6e-24 ref|XP_007144829.1| hypothetical protein PHAVU_007G187600g [Phas... 114 1e-23 ref|XP_003556470.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_003630353.1| Pentatricopeptide repeat-containing protein ... 114 2e-23 gb|AFK45023.1| unknown [Medicago truncatula] 114 2e-23 ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 emb|CBI15328.3| unnamed protein product [Vitis vinifera] 110 2e-22 ref|XP_004503897.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-21 ref|XP_004138218.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_006394550.1| hypothetical protein EUTSA_v10004006mg [Eutr... 98 1e-18 ref|NP_200904.1| pentatricopeptide repeat-containing protein [Ar... 97 2e-18 ref|XP_002866406.1| pentatricopeptide repeat-containing protein ... 97 2e-18 gb|AAM63453.1| unknown [Arabidopsis thaliana] 97 2e-18 ref|XP_007037613.1| Pentatricopeptide repeat-containing protein,... 97 3e-18 ref|XP_006282075.1| hypothetical protein CARUB_v10028321mg [Caps... 97 3e-18 ref|XP_006477702.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_006440794.1| hypothetical protein CICLE_v10019809mg [Citr... 96 4e-18 ref|XP_006345106.1| PREDICTED: pentatricopeptide repeat-containi... 93 4e-17 ref|XP_002514631.1| pentatricopeptide repeat-containing protein,... 91 2e-16 ref|XP_004301536.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 >ref|XP_003536123.1| PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial-like [Glycine max] Length = 509 Score = 115 bits (288), Expect = 6e-24 Identities = 52/71 (73%), Positives = 63/71 (88%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 SD LS++QRL+L+FSHITPTP LIL LNLS +AGRT LGFH+W++SNP+F+ +DDT SY Sbjct: 80 SDALSVSQRLNLSFSHITPTPNLILQTLNLSPQAGRTVLGFHQWLSSNPQFSHTDDTLSY 139 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 140 FVDYFGRRKDF 150 >ref|XP_007144829.1| hypothetical protein PHAVU_007G187600g [Phaseolus vulgaris] gi|561018019|gb|ESW16823.1| hypothetical protein PHAVU_007G187600g [Phaseolus vulgaris] Length = 505 Score = 114 bits (286), Expect = 1e-23 Identities = 52/71 (73%), Positives = 61/71 (85%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 SDPLS++QRL L+FSHITPTP LIL LNLS +AGRT LGFH+W++SNP+F +D T SY Sbjct: 77 SDPLSVSQRLHLSFSHITPTPNLILQTLNLSPQAGRTVLGFHQWLSSNPQFTHTDHTLSY 136 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 137 FVDYFGRRKDF 147 >ref|XP_003556470.1| PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial-like isoformX1 [Glycine max] Length = 509 Score = 114 bits (286), Expect = 1e-23 Identities = 52/71 (73%), Positives = 62/71 (87%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 SD LS++QRL L+FSHITPTP LIL LNLS E+GRT LGFH+W++SNP+F+ +DDT SY Sbjct: 81 SDALSVSQRLHLSFSHITPTPNLILQTLNLSHESGRTVLGFHQWLSSNPQFSHTDDTLSY 140 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 141 FVDYFGRRKDF 151 >ref|XP_003630353.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524375|gb|AET04829.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 114 bits (284), Expect = 2e-23 Identities = 52/71 (73%), Positives = 59/71 (83%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 SDP S+ QRL+L+FSHITPTP LIL LNLS EAGR LGFH+W+ SNPKF +D+T SY Sbjct: 93 SDPSSVTQRLNLSFSHITPTPNLILETLNLSLEAGRNVLGFHQWLASNPKFTHTDETLSY 152 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 153 FVDYFGRRKDF 163 >gb|AFK45023.1| unknown [Medicago truncatula] Length = 521 Score = 114 bits (284), Expect = 2e-23 Identities = 52/71 (73%), Positives = 59/71 (83%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 SDP S+ QRL+L+FSHITPTP LIL LNLS EAGR LGFH+W+ SNPKF +D+T SY Sbjct: 93 SDPSSVTQRLNLSFSHITPTPNLILETLNLSLEAGRNVLGFHQWLASNPKFTHTDETLSY 152 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 153 FVDYFGRRKDF 163 >ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Vitis vinifera] Length = 516 Score = 110 bits (276), Expect = 2e-22 Identities = 50/71 (70%), Positives = 60/71 (84%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 S+P+ I QRL L+FSHITP+PPLIL LN S +AGRT LGF+KW++SNPKF SD+T S+ Sbjct: 87 SEPVPIIQRLQLSFSHITPSPPLILQTLNTSPDAGRTVLGFYKWLSSNPKFVHSDETISF 146 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 147 FVDYFGRRKDF 157 >emb|CBI15328.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 110 bits (276), Expect = 2e-22 Identities = 50/71 (70%), Positives = 60/71 (84%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 S+P+ I QRL L+FSHITP+PPLIL LN S +AGRT LGF+KW++SNPKF SD+T S+ Sbjct: 103 SEPVPIIQRLQLSFSHITPSPPLILQTLNTSPDAGRTVLGFYKWLSSNPKFVHSDETISF 162 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 163 FVDYFGRRKDF 173 >ref|XP_004503897.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Cicer arietinum] Length = 516 Score = 106 bits (264), Expect = 4e-21 Identities = 48/73 (65%), Positives = 58/73 (79%) Frame = +2 Query: 5 TSSDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTF 184 + SDP S+ +RL L+FSHITPTP +IL L+LS EAGR LGFH+W+ SNPKF +D+T Sbjct: 87 SDSDPSSVAERLHLSFSHITPTPNVILQTLDLSPEAGRIVLGFHQWLASNPKFTHTDETV 146 Query: 185 SYFVDYFGRRKDF 223 SYFVDYFGRR DF Sbjct: 147 SYFVDYFGRRNDF 159 >ref|XP_004138218.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Cucumis sativus] gi|449477122|ref|XP_004154936.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Cucumis sativus] Length = 522 Score = 104 bits (260), Expect = 1e-20 Identities = 47/71 (66%), Positives = 57/71 (80%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 SDPL I QRL L+FSH+ P P L+ + LNLSSEAGRT LGF++W+ SNP F +D+T SY Sbjct: 92 SDPLPITQRLQLSFSHVKPNPELVRNTLNLSSEAGRTVLGFNEWLVSNPDFHHTDETISY 151 Query: 191 FVDYFGRRKDF 223 FVD+FGRRKDF Sbjct: 152 FVDFFGRRKDF 162 >ref|XP_006394550.1| hypothetical protein EUTSA_v10004006mg [Eutrema salsugineum] gi|557091189|gb|ESQ31836.1| hypothetical protein EUTSA_v10004006mg [Eutrema salsugineum] Length = 518 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/71 (63%), Positives = 56/71 (78%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 ++P SI+Q L+FSHITP P LIL LNLS EAGR ALGF++W+ SN F+ +D+T S+ Sbjct: 86 AEPQSISQSFQLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSGFSHTDETVSF 145 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 146 FVDYFGRRKDF 156 >ref|NP_200904.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75262710|sp|Q9FME4.1|PP438_ARATH RecName: Full=Pentatricopeptide repeat-containing protein PNM1, mitochondrial; AltName: Full=PPR PROTEIN LOCALIZED TO THE NUCLEUS AND MITOCHONDRIA 1; Flags: Precursor gi|10177319|dbj|BAB10645.1| unnamed protein product [Arabidopsis thaliana] gi|332010020|gb|AED97403.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 521 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/67 (65%), Positives = 55/67 (82%) Frame = +2 Query: 23 SINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSYFVDY 202 +I+QR +L+FSHITP P LIL LNLS EAGR ALGF++W+ SN F+ +D+T S+FVDY Sbjct: 93 TISQRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNFSHTDETVSFFVDY 152 Query: 203 FGRRKDF 223 FGRRKDF Sbjct: 153 FGRRKDF 159 >ref|XP_002866406.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312241|gb|EFH42665.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 522 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/67 (65%), Positives = 55/67 (82%) Frame = +2 Query: 23 SINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSYFVDY 202 +I+QR +L+FSHITP P LIL LNLS EAGR ALGF++W+ SN F+ +D+T S+FVDY Sbjct: 94 AISQRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNFSHTDETVSFFVDY 153 Query: 203 FGRRKDF 223 FGRRKDF Sbjct: 154 FGRRKDF 160 >gb|AAM63453.1| unknown [Arabidopsis thaliana] Length = 521 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/67 (65%), Positives = 55/67 (82%) Frame = +2 Query: 23 SINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSYFVDY 202 +I+QR +L+FSHITP P LIL LNLS EAGR ALGF++W+ SN F+ +D+T S+FVDY Sbjct: 93 TISQRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNFSHTDETVSFFVDY 152 Query: 203 FGRRKDF 223 FGRRKDF Sbjct: 153 FGRRKDF 159 >ref|XP_007037613.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508774858|gb|EOY22114.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 494 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/70 (64%), Positives = 53/70 (75%) Frame = +2 Query: 14 DPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSYF 193 DPL I QRL L+FSHI PT LI LNLS EAGRT LGF+ W+ S+P F +D+T S+F Sbjct: 66 DPLPITQRLQLSFSHIKPTSLLISQTLNLSPEAGRTVLGFNDWLLSDPNFNHTDETLSFF 125 Query: 194 VDYFGRRKDF 223 +DYFGRRKDF Sbjct: 126 IDYFGRRKDF 135 >ref|XP_006282075.1| hypothetical protein CARUB_v10028321mg [Capsella rubella] gi|482550779|gb|EOA14973.1| hypothetical protein CARUB_v10028321mg [Capsella rubella] Length = 522 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = +2 Query: 23 SINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSYFVDY 202 SI+QR +L+FSHITP P LIL LNLS EAGR ALGF++W+ S+ F+ +D+T SYFVDY Sbjct: 94 SISQRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSSNGFSHTDETVSYFVDY 153 Query: 203 FGRRKDF 223 FGRRKDF Sbjct: 154 FGRRKDF 160 >ref|XP_006477702.1| PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial-like [Citrus sinensis] Length = 503 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/71 (60%), Positives = 53/71 (74%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 +DPL I+QRL L FSH+TPTP L+ LN S EAGR LGF+ W+T N F+ +D+T S+ Sbjct: 77 ADPLPISQRLHLIFSHVTPTPSLVQSTLNFSPEAGRAILGFNHWLTQNANFSHTDETLSF 136 Query: 191 FVDYFGRRKDF 223 F DYFGRRKDF Sbjct: 137 FTDYFGRRKDF 147 >ref|XP_006440794.1| hypothetical protein CICLE_v10019809mg [Citrus clementina] gi|557543056|gb|ESR54034.1| hypothetical protein CICLE_v10019809mg [Citrus clementina] Length = 503 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/71 (60%), Positives = 53/71 (74%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 +DPL I+QRL L FSH+TPTP L+ LN S EAGR LGF+ W+T N F+ +D+T S+ Sbjct: 77 ADPLPISQRLHLIFSHVTPTPSLVQSTLNFSPEAGRAILGFNHWLTQNANFSHTDETLSF 136 Query: 191 FVDYFGRRKDF 223 F DYFGRRKDF Sbjct: 137 FTDYFGRRKDF 147 >ref|XP_006345106.1| PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial-like [Solanum tuberosum] Length = 521 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/71 (63%), Positives = 51/71 (71%) Frame = +2 Query: 11 SDPLSINQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSY 190 ++ LSI Q LDL+FSH+ TP LIL LNLS +AGRT LGF KWV S F D+ SY Sbjct: 90 AESLSIPQSLDLSFSHVNLTPSLILTTLNLSPDAGRTVLGFFKWVKSKESFKVDDEVVSY 149 Query: 191 FVDYFGRRKDF 223 FVDYFGRRKDF Sbjct: 150 FVDYFGRRKDF 160 >ref|XP_002514631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546235|gb|EEF47737.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 569 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 2/74 (2%) Frame = +2 Query: 8 SSDPLSINQRLDLNFSHITP--TPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDT 181 +SD LSI QRL+L+FSHI TP +IL LNLS +AGRT LGFH+W+ F +D+T Sbjct: 136 NSDSLSILQRLNLHFSHINNSITPSIILQTLNLSPDAGRTVLGFHQWLVKVANFKNTDET 195 Query: 182 FSYFVDYFGRRKDF 223 S+F+DYFGRRKDF Sbjct: 196 ISFFIDYFGRRKDF 209 >ref|XP_004301536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 517 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/66 (59%), Positives = 52/66 (78%) Frame = +2 Query: 26 INQRLDLNFSHITPTPPLILHVLNLSSEAGRTALGFHKWVTSNPKFAPSDDTFSYFVDYF 205 + + L +F ++TPTP L+L VLNLS+EAGR LGF++W+ NP+F +D+T SYFVDYF Sbjct: 93 VTKTLQSSFPNVTPTPSLVLSVLNLSAEAGRAVLGFNQWLIHNPRFDHTDETLSYFVDYF 152 Query: 206 GRRKDF 223 GRRKDF Sbjct: 153 GRRKDF 158