BLASTX nr result
ID: Paeonia22_contig00022788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00022788 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryp... 39 2e-06 ref|XP_002516188.1| Pectinesterase-3 precursor, putative [Ricinu... 40 6e-06 >gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides] Length = 584 Score = 39.3 bits (90), Expect(2) = 2e-06 Identities = 20/37 (54%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -1 Query: 262 VPKTK--LIFIGDGVVVTKITANHSNRTGYSTFNSST 158 +PK K L+FIGDG VT +TAN + GY+TF+S+T Sbjct: 316 IPKNKHNLMFIGDGKDVTVVTANRNVVDGYTTFHSAT 352 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = -2 Query: 354 TAAVDAAPSMSKFSFTIRV*QGIYNENVDIPFQKPN 247 +AAV AAP S + I + +G+Y ENVDIP K N Sbjct: 287 SAAVAAAPEKSTSRYVIHIKKGVYQENVDIPKNKHN 322 >ref|XP_002516188.1| Pectinesterase-3 precursor, putative [Ricinus communis] gi|223544674|gb|EEF46190.1| Pectinesterase-3 precursor, putative [Ricinus communis] Length = 541 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = -2 Query: 348 AVDAAPSMSKFSFTIRV*QGIYNENVDIPFQKPN 247 AV AAPS S + IR+ G+Y ENVDIP K N Sbjct: 290 AVAAAPSRSSTRYVIRIKAGVYRENVDIPSSKTN 323 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = -1 Query: 256 KTKLIFIGDGVVVTKITANHSNRTGYSTFNSSTM 155 KT L+F+GDG T IT + S G +TFNS+T+ Sbjct: 321 KTNLMFVGDGSTTTIITGSRSVVGGSTTFNSATV 354