BLASTX nr result
ID: Paeonia22_contig00022180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00022180 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007156337.1| hypothetical protein PHAVU_003G278000g [Phas... 77 3e-12 ref|XP_007040884.1| Tetratricopeptide repeat-like superfamily pr... 73 5e-11 ref|XP_003548696.2| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_006494102.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006432897.1| hypothetical protein CICLE_v10000932mg [Citr... 68 1e-09 ref|XP_004509496.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_003629008.1| Pentatricopeptide repeat-containing protein ... 68 2e-09 ref|XP_004166808.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_004150822.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 gb|EYU37434.1| hypothetical protein MIMGU_mgv1a023557mg [Mimulus... 64 2e-08 ref|XP_002303222.1| hypothetical protein POPTR_0003s03950g [Popu... 60 2e-07 emb|CBI33534.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002272930.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004173996.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 ref|XP_004140363.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 ref|XP_002532468.1| pentatricopeptide repeat-containing protein,... 56 5e-06 >ref|XP_007156337.1| hypothetical protein PHAVU_003G278000g [Phaseolus vulgaris] gi|561029691|gb|ESW28331.1| hypothetical protein PHAVU_003G278000g [Phaseolus vulgaris] Length = 514 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FPSHLDAPNVS AR +C++LT+A HDIE+ALS++GI P +++EEVLKLSY Sbjct: 39 FPSHLDAPNVSSTARAICDILTRASPHDIETALSSSGIVPEDDLIEEVLKLSY 91 >ref|XP_007040884.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590680522|ref|XP_007040885.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508778129|gb|EOY25385.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508778130|gb|EOY25386.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 491 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/53 (58%), Positives = 44/53 (83%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 F +HLDAP++SP ARILC++L++A HD+E+ALS TGI+P E+++EVL SY Sbjct: 34 FRTHLDAPDISPTARILCDLLSRASPHDVETALSCTGITPTAEVIQEVLSFSY 86 >ref|XP_003548696.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Glycine max] Length = 492 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FPSHLDAPNVS AR LC++LT++ DIESALS++GI P E EVL+LSY Sbjct: 34 FPSHLDAPNVSSTARALCDILTRSSPQDIESALSSSGIVPEEECTNEVLRLSY 86 >ref|XP_006494102.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Citrus sinensis] Length = 463 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FP+H DAP +S ARI+CE+L A DIESAL+ TGI P P++V EVL+LSY Sbjct: 40 FPTHHDAPYISSSARIICEILAHASSDDIESALACTGIIPTPDLVHEVLQLSY 92 >ref|XP_006432897.1| hypothetical protein CICLE_v10000932mg [Citrus clementina] gi|568882584|ref|XP_006494101.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Citrus sinensis] gi|557535019|gb|ESR46137.1| hypothetical protein CICLE_v10000932mg [Citrus clementina] Length = 499 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FP+H DAP +S ARI+CE+L A DIESAL+ TGI P P++V EVL+LSY Sbjct: 40 FPTHHDAPYISSSARIICEILAHASSDDIESALACTGIIPTPDLVHEVLQLSY 92 >ref|XP_004509496.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cicer arietinum] Length = 499 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FPSHLD PNVS AR LC +LT+ DI++ALS++GI P E V EVLKLSY Sbjct: 41 FPSHLDTPNVSSTARTLCNLLTRTSPQDIDTALSSSGIHPSEECVHEVLKLSY 93 >ref|XP_003629008.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523030|gb|AET03484.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 543 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FPSHLD PNVS AR LC +LT+ DI++ALS++GI P E V EVLKLSY Sbjct: 41 FPSHLDTPNVSSTARTLCNLLTRTSPQDIDNALSSSGIHPSEECVHEVLKLSY 93 >ref|XP_004166808.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Length = 503 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FP HLD P++SP A+ +CEVL + ++++ AL ATG++P PE+V+EVL++SY Sbjct: 45 FPLHLDLPDISPAAKTICEVLVRVSRNEVDGALLATGLAPSPELVQEVLRVSY 97 >ref|XP_004150822.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Length = 487 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FP HLD P++SP A+ +CEVL + ++++ AL ATG++P PE+V+EVL++SY Sbjct: 29 FPLHLDLPDISPAAKTICEVLVRVSRNEVDGALLATGLAPSPELVQEVLRVSY 81 >gb|EYU37434.1| hypothetical protein MIMGU_mgv1a023557mg [Mimulus guttatus] Length = 474 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FP+++ + ++SP+ARILCE+L AP+H++E+ L +T I P PE ++VLKLSY Sbjct: 17 FPTYITSVDISPQARILCEILAAAPVHEVEARLGSTLIQPDPETAQQVLKLSY 69 >ref|XP_002303222.1| hypothetical protein POPTR_0003s03950g [Populus trichocarpa] gi|222840654|gb|EEE78201.1| hypothetical protein POPTR_0003s03950g [Populus trichocarpa] Length = 472 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 F S D+ ++SP AR+L E++T+ HDIESALS+TGI P +IV EVLKL + Sbjct: 17 FESSFDSQDISPSARLLFEIITRPSSHDIESALSSTGIPPTHDIVHEVLKLCH 69 >emb|CBI33534.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FP++L+ PN+SP+ R+LCE++ P +E L T I PE VE+ LKLSY Sbjct: 50 FPTYLETPNLSPKVRLLCEIIANTPSSTVEEVLHDTAIRVSPEDVEDSLKLSY 102 >ref|XP_002272930.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vitis vinifera] Length = 502 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FP++L+ PN+SP+ R+LCE++ P +E L T I PE VE+ LKLSY Sbjct: 46 FPTYLETPNLSPKVRLLCEIIANTPSSTVEEVLHDTAIRVSPEDVEDSLKLSY 98 >ref|XP_004173996.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like, partial [Cucumis sativus] Length = 391 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/54 (48%), Positives = 37/54 (68%) Frame = +2 Query: 101 HFPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 HF S+LD PN+ + +++CE++ +P D+E AL TGI + VEEVLKLSY Sbjct: 60 HFLSYLDFPNLPFQIKLMCEIIANSPSLDVEKALEDTGIHATQQDVEEVLKLSY 113 >ref|XP_004140363.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Length = 519 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/54 (48%), Positives = 37/54 (68%) Frame = +2 Query: 101 HFPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 HF S+LD PN+ + +++CE++ +P D+E AL TGI + VEEVLKLSY Sbjct: 60 HFLSYLDFPNLPFQIKLMCEIIANSPSLDVEKALEDTGIHATQQDVEEVLKLSY 113 >ref|XP_002532468.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527826|gb|EEF29924.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 510 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/53 (45%), Positives = 37/53 (69%) Frame = +2 Query: 104 FPSHLDAPNVSPRARILCEVLTKAPLHDIESALSATGISPLPEIVEEVLKLSY 262 FPS+L+ PN+SP+ ++LCE++ K P +E+ L TG+ VE+V+KLSY Sbjct: 54 FPSYLETPNLSPKIKLLCEIIAKIPSSTVETILDETGLYVSQYDVEQVIKLSY 106