BLASTX nr result
ID: Paeonia22_contig00022079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00022079 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628538.1| S-locus receptor kinase [Medicago truncatula... 58 1e-06 ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like prote... 57 2e-06 emb|CAN80208.1| hypothetical protein VITISV_010567 [Vitis vinifera] 57 2e-06 ref|XP_007143190.1| hypothetical protein PHAVU_007G051200g [Phas... 57 3e-06 gb|EXB67311.1| Cysteine-rich receptor-like protein kinase 25 [Mo... 56 6e-06 gb|EXB50923.1| Cysteine-rich receptor-like protein kinase 25 [Mo... 55 8e-06 gb|EXB29712.1| Cysteine-rich receptor-like protein kinase 25 [Mo... 55 8e-06 >ref|XP_003628538.1| S-locus receptor kinase [Medicago truncatula] gi|355522560|gb|AET03014.1| S-locus receptor kinase [Medicago truncatula] Length = 750 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +2 Query: 2 LGFCLEREQKILIYEYVPNHSLDYFLFGLI--HINIDLLFNFSNCGC 136 LG C+ER++K+LIYE++PN SLD+F+FGL I +LFN SNC C Sbjct: 467 LGCCIERDEKMLIYEFMPNKSLDFFIFGLYFSETKISILFN-SNCSC 512 >ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like isoform 1 [Vitis vinifera] Length = 663 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 2 LGFCLEREQKILIYEYVPNHSLDYFLFGL 88 LGFCLE E+KIL+YEYVPN SLDYFLFGL Sbjct: 394 LGFCLEGEEKILVYEYVPNKSLDYFLFGL 422 >emb|CAN80208.1| hypothetical protein VITISV_010567 [Vitis vinifera] Length = 614 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +2 Query: 2 LGFCLEREQKILIYEYVPNHSLDYFLFGLIHIN 100 LGFCLE ++KIL+YE+VPN SLDYFLFGL++++ Sbjct: 405 LGFCLEAKEKILVYEFVPNKSLDYFLFGLLYLH 437 >ref|XP_007143190.1| hypothetical protein PHAVU_007G051200g [Phaseolus vulgaris] gi|561016380|gb|ESW15184.1| hypothetical protein PHAVU_007G051200g [Phaseolus vulgaris] Length = 663 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 2 LGFCLEREQKILIYEYVPNHSLDYFLFG 85 +GFCLE E+KILIYEYVPN SLDYFLFG Sbjct: 398 MGFCLEEEEKILIYEYVPNRSLDYFLFG 425 >gb|EXB67311.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis] Length = 383 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 5 GFCLEREQKILIYEYVPNHSLDYFLFG 85 GFCLERE+KILIYE+VPN SLDYFLFG Sbjct: 357 GFCLEREEKILIYEFVPNKSLDYFLFG 383 >gb|EXB50923.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis] Length = 1170 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 2 LGFCLEREQKILIYEYVPNHSLDYFLF 82 LGFCLER++KILIYEYVPN SLDYFLF Sbjct: 872 LGFCLERDEKILIYEYVPNKSLDYFLF 898 >gb|EXB29712.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis] Length = 1110 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 5 GFCLEREQKILIYEYVPNHSLDYFLF 82 GFCLERE+KILIYEYVPN SLDYFLF Sbjct: 396 GFCLEREEKILIYEYVPNRSLDYFLF 421