BLASTX nr result
ID: Paeonia22_contig00021888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00021888 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281414.2| PREDICTED: methyl-CpG-binding domain-contain... 61 2e-07 emb|CAN67324.1| hypothetical protein VITISV_012829 [Vitis vinifera] 61 2e-07 ref|XP_004487033.1| PREDICTED: methyl-CpG-binding domain-contain... 59 9e-07 ref|XP_007207835.1| hypothetical protein PRUPE_ppa023402mg [Prun... 59 9e-07 ref|XP_007206215.1| hypothetical protein PRUPE_ppa015252mg [Prun... 59 9e-07 ref|XP_006488261.1| PREDICTED: methyl-CpG-binding domain-contain... 57 2e-06 ref|XP_006424754.1| hypothetical protein CICLE_v10028859mg [Citr... 57 2e-06 ref|XP_006424752.1| hypothetical protein CICLE_v10028859mg [Citr... 57 2e-06 ref|XP_006424751.1| hypothetical protein CICLE_v10028859mg [Citr... 57 2e-06 ref|XP_004251455.1| PREDICTED: methyl-CpG-binding domain-contain... 57 3e-06 ref|XP_006363366.1| PREDICTED: methyl-CpG-binding domain-contain... 56 6e-06 ref|XP_002533112.1| hypothetical protein RCOM_0391080 [Ricinus c... 55 8e-06 >ref|XP_002281414.2| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Vitis vinifera] gi|297746130|emb|CBI16186.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGP-GDAWCPLMGGLMVPDSEKQQWAKIFV 262 KK SS + KTS+ KPP K+ WVL GP GD W P + VP+S KQ WAKIF+ Sbjct: 149 KKNNSSTKVKTSTSHFIKPPKKVNWVLTGPGGDVWSPYINASAVPESIKQTWAKIFM 205 >emb|CAN67324.1| hypothetical protein VITISV_012829 [Vitis vinifera] Length = 212 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGP-GDAWCPLMGGLMVPDSEKQQWAKIFV 262 KK SS + KTS+ KPP K+ WVL GP GD W P + VP+S KQ WAKIF+ Sbjct: 149 KKNNSSTKVKTSTSHFIKPPKKVNWVLTGPGGDVWSPYINASAVPESIKQTWAKIFM 205 >ref|XP_004487033.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Cicer arietinum] Length = 222 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/59 (38%), Positives = 38/59 (64%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGPGDAWCPLMGGLMVPDSEKQQWAKIFVSTV 253 KK + + + S +L +PP K+ WVL GPG W P + +VP+SEK +W+K F++++ Sbjct: 158 KKNNTGEDDRGSVHNLTRPPTKVSWVLAGPGGLWNPFLDDSLVPESEKLKWSKAFITSI 216 >ref|XP_007207835.1| hypothetical protein PRUPE_ppa023402mg [Prunus persica] gi|462403477|gb|EMJ09034.1| hypothetical protein PRUPE_ppa023402mg [Prunus persica] Length = 142 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = -3 Query: 426 KTISSHEAKTSSFDLGKPPLKIRWVLQGPGDA-WCPLMGGLMVPDSEKQQWAKIFVSTVK 250 + I+ + S + G+PP K++WVL GPG W P M VPDS Q+W+K FVS++ Sbjct: 74 RNITGANDRPSKLNFGRPPAKVKWVLGGPGGCMWNPFMDESKVPDSVLQKWSKTFVSSLY 133 Query: 249 YRNSNAP 229 N AP Sbjct: 134 GGNIGAP 140 >ref|XP_007206215.1| hypothetical protein PRUPE_ppa015252mg [Prunus persica] gi|462401857|gb|EMJ07414.1| hypothetical protein PRUPE_ppa015252mg [Prunus persica] Length = 183 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGPGDA-WCPLMGGLMVPDSEKQQWAKIFVSTV 253 KK IS + S + G P K+ WVL G G + W P M VPDS KQ+W++IFVS + Sbjct: 114 KKNISGENDRPSMLNFGIPTAKVNWVLGGTGGSMWNPFMEDSKVPDSVKQKWSEIFVSAI 173 Query: 252 KYRNSNAP 229 N +AP Sbjct: 174 YGGNISAP 181 >ref|XP_006488261.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Citrus sinensis] Length = 313 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/60 (41%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTV 253 +K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++ Sbjct: 250 EKDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSI 309 >ref|XP_006424754.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526688|gb|ESR37994.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] Length = 238 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/60 (41%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTV 253 +K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++ Sbjct: 175 EKDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSI 234 >ref|XP_006424752.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|567864208|ref|XP_006424753.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526686|gb|ESR37992.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526687|gb|ESR37993.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] Length = 315 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/60 (41%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTV 253 +K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++ Sbjct: 252 EKDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSI 311 >ref|XP_006424751.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526685|gb|ESR37991.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] Length = 169 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/60 (41%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTV 253 +K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++ Sbjct: 106 EKDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSI 165 >ref|XP_004251455.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Solanum lycopersicum] Length = 285 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = -3 Query: 375 PPLKIRWVLQGP-GDAWCPLMGGLMVPDSEKQQWAKIFVSTVKYRNSNAPK 226 PP K+ WVL P GDAW PL+ G +PDS KQQW K F + N NA K Sbjct: 233 PPAKVNWVLSSPKGDAWNPLISGTPIPDSLKQQWTKRFKLFMNDENLNAEK 283 >ref|XP_006363366.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Solanum tuberosum] Length = 291 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/67 (44%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -3 Query: 429 KKTISSHEAKTSSFDLGKPPLKIRWVLQGP-GDAWCPLMGGLMVPDSEKQQWAKIFVSTV 253 K I + + SSF PP K+ WVL P GDAW P + G +PDS KQQW K F+ + Sbjct: 223 KGNIVTENSDKSSFL--SPPAKVNWVLSSPKGDAWNPFIAGTPIPDSVKQQWTKRFMLFM 280 Query: 252 KYRNSNA 232 N NA Sbjct: 281 NGENLNA 287 >ref|XP_002533112.1| hypothetical protein RCOM_0391080 [Ricinus communis] gi|223527103|gb|EEF29284.1| hypothetical protein RCOM_0391080 [Ricinus communis] Length = 176 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/58 (41%), Positives = 35/58 (60%) Frame = -3 Query: 420 ISSHEAKTSSFDLGKPPLKIRWVLQGPGDAWCPLMGGLMVPDSEKQQWAKIFVSTVKY 247 + H KTS DL PP++I+WVL G+AW PL+ + +S K +W + FV T+ Y Sbjct: 118 LGEHTVKTSLVDLHNPPVRIKWVLGPRGNAWSPLIDDTRILESVKHKWFETFVWTLNY 175